BLASTX nr result
ID: Panax24_contig00021783
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00021783 (360 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OIT04243.1 hypothetical protein A4A49_22702 [Nicotiana attenuata] 65 1e-11 NP_064004.1 orf107b gene product (mitochondrion) [Beta vulgaris ... 60 3e-09 KJB09779.1 hypothetical protein B456_001G164700, partial [Gossyp... 55 2e-06 >OIT04243.1 hypothetical protein A4A49_22702 [Nicotiana attenuata] Length = 81 Score = 65.5 bits (158), Expect = 1e-11 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = +1 Query: 232 ACSRSLLAYVVVGLPTRTRPQECLLGSGRSQADTYDRRRKDP 357 +CS SLLAYVVV LP RP ECLLGSGR QADTY+R R+DP Sbjct: 17 SCSNSLLAYVVVELPALIRPPECLLGSGRRQADTYNRGREDP 58 >NP_064004.1 orf107b gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] YP_004222369.1 hypothetical protein BevumaM_p136 (mitochondrion) [Beta vulgaris subsp. maritima] YP_004842174.1 hypothetical protein BemaM_p130 (mitochondrion) [Beta macrocarpa] BAA99316.1 orf107b (mitochondrion) [Beta vulgaris subsp. vulgaris] CBJ14008.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] CBJ17584.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] CBJ20702.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] CBX24979.1 hypothetical protein (mitochondrion) [Beta macrocarpa] CBL54138.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 107 Score = 59.7 bits (143), Expect = 3e-09 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -1 Query: 357 GVFPSPIVCIGLASSRTKEAFLRARACRKADDYIS 253 GVFPSPIVCIGLASSR+K +LRARACRKAD YIS Sbjct: 74 GVFPSPIVCIGLASSRSK-LYLRARACRKADHYIS 107 >KJB09779.1 hypothetical protein B456_001G164700, partial [Gossypium raimondii] Length = 231 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 356 GSFLRLSYVSAWLRPEPRRHSCGRVR 279 GSFLRLSYVSAWLRPEPRRHS GRVR Sbjct: 156 GSFLRLSYVSAWLRPEPRRHSGGRVR 181