BLASTX nr result
ID: Panax24_contig00021701
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00021701 (686 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EYU39701.1 hypothetical protein MIMGU_mgv11b022363mg, partial [E... 127 1e-34 AKZ21719.1 ATP synthase CF0 A subunit (plastid) [Penstemon angus... 131 5e-34 APU51442.1 ATP synthase CF0 A subunit IV (chloroplast) [Sambucus... 130 1e-33 YP_009326506.1 ATP synthase CF0 A subunit IV (chloroplast) [Sina... 130 1e-33 YP_009244998.1 ATP synthase CF0 A chain (chloroplast) [Kolkwitzi... 130 1e-33 YP_009241040.1 ATP synthase CF0 A subunit (chloroplast) [Scheffl... 130 1e-33 YP_086954.1 ATP synthase CF0 A subunit [Panax ginseng] Q68S18.1 ... 130 1e-33 ALI89399.1 AtpI, partial (chloroplast) [Garrya flavescens] 130 1e-33 YP_009159526.1 AtpI (chloroplast) [Dendropanax morbifer] YP_0092... 130 1e-33 YP_009330679.1 ATP synthase CF0 A subunit IV (chloroplast) [Vibu... 130 1e-33 AII18533.1 ATPI synthase CF0 subunit IV, partial (chloroplast) [... 130 1e-33 YP_009130949.1 ATP synthase CF0 A chain (chloroplast) [Lonicera ... 130 1e-33 ADD31541.1 ATP synthase CF0 subunit IV protein (chloroplast) [Au... 130 1e-33 ADK89681.1 ATP synthase CF0 subunit IV (chloroplast) [Hydrocotyl... 130 1e-33 YP_004935540.1 ATP synthase CF0 A subunit (chloroplast) [Eleuthe... 130 1e-33 YP_009255594.1 ATP synthase CF0 A subunit (chloroplast) [Cornus ... 129 2e-33 ANS81189.1 ATP synthase CFO A subunit IV (chloroplast) [Ilex del... 129 3e-33 ADD31554.1 ATP synthase CF0 subunit IV protein (chloroplast) [Co... 129 3e-33 ADD31544.1 ATP synthase CF0 subunit IV protein (chloroplast) [Il... 129 3e-33 YP_009336364.1 ATP synthase CF0 subunit IV (chloroplast) [Nicoti... 129 4e-33 >EYU39701.1 hypothetical protein MIMGU_mgv11b022363mg, partial [Erythranthe guttata] Length = 81 Score = 127 bits (319), Expect = 1e-34 Identities = 61/63 (96%), Positives = 62/63 (98%) Frame = -2 Query: 319 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN 140 MNVLSCSINTLKGLYDISGVEVGQHFYW+IGGFQVHGQVLITSWVVIAILLGSATI VRN Sbjct: 1 MNVLSCSINTLKGLYDISGVEVGQHFYWQIGGFQVHGQVLITSWVVIAILLGSATIVVRN 60 Query: 139 PQT 131 PQT Sbjct: 61 PQT 63 >AKZ21719.1 ATP synthase CF0 A subunit (plastid) [Penstemon angustifolius] AKZ21720.1 ATP synthase CF0 A subunit (plastid) [Penstemon gracilis] Length = 249 Score = 131 bits (329), Expect = 5e-34 Identities = 63/64 (98%), Positives = 64/64 (100%) Frame = -2 Query: 322 NMNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVR 143 NMNVLSCSINTLKGLYDISGVEVGQHFYW+IGGFQVHGQVLITSWVVIAILLGSATIAVR Sbjct: 2 NMNVLSCSINTLKGLYDISGVEVGQHFYWQIGGFQVHGQVLITSWVVIAILLGSATIAVR 61 Query: 142 NPQT 131 NPQT Sbjct: 62 NPQT 65 >APU51442.1 ATP synthase CF0 A subunit IV (chloroplast) [Sambucus williamsii] Length = 247 Score = 130 bits (327), Expect = 1e-33 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -2 Query: 319 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN 140 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN Sbjct: 1 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN 60 Query: 139 PQT 131 PQT Sbjct: 61 PQT 63 >YP_009326506.1 ATP synthase CF0 A subunit IV (chloroplast) [Sinadoxa corydalifolia] APD52556.1 ATP synthase CF0 A subunit IV (chloroplast) [Sinadoxa corydalifolia] Length = 247 Score = 130 bits (327), Expect = 1e-33 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -2 Query: 319 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN 140 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN Sbjct: 1 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN 60 Query: 139 PQT 131 PQT Sbjct: 61 PQT 63 >YP_009244998.1 ATP synthase CF0 A chain (chloroplast) [Kolkwitzia amabilis] AMR73768.1 ATP synthase CF0 A chain (chloroplast) [Kolkwitzia amabilis] Length = 247 Score = 130 bits (327), Expect = 1e-33 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -2 Query: 319 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN 140 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN Sbjct: 1 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN 60 Query: 139 PQT 131 PQT Sbjct: 61 PQT 63 >YP_009241040.1 ATP synthase CF0 A subunit (chloroplast) [Schefflera heptaphylla] AMK46191.1 ATP synthase CF0 A subunit (chloroplast) [Schefflera heptaphylla] Length = 247 Score = 130 bits (327), Expect = 1e-33 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -2 Query: 319 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN 140 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN Sbjct: 1 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN 60 Query: 139 PQT 131 PQT Sbjct: 61 PQT 63 >YP_086954.1 ATP synthase CF0 A subunit [Panax ginseng] Q68S18.1 RecName: Full=ATP synthase subunit a, chloroplastic; AltName: Full=ATP synthase F0 sector subunit a; AltName: Full=F-ATPase subunit IV AAT98497.1 ATPase subunit IV (chloroplast) [Panax ginseng] Length = 247 Score = 130 bits (327), Expect = 1e-33 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -2 Query: 319 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN 140 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN Sbjct: 1 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN 60 Query: 139 PQT 131 PQT Sbjct: 61 PQT 63 >ALI89399.1 AtpI, partial (chloroplast) [Garrya flavescens] Length = 247 Score = 130 bits (327), Expect = 1e-33 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -2 Query: 319 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN 140 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN Sbjct: 1 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN 60 Query: 139 PQT 131 PQT Sbjct: 61 PQT 63 >YP_009159526.1 AtpI (chloroplast) [Dendropanax morbifer] YP_009266506.1 AtpI (chloroplast) [Panax stipuleanatus] AKQ20716.1 AtpI (chloroplast) [Dendropanax morbifer] ANK78318.1 AtpI (chloroplast) [Panax japonicus var. bipinnatifidus] ANK78404.1 AtpI (chloroplast) [Panax stipuleanatus] Length = 247 Score = 130 bits (327), Expect = 1e-33 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -2 Query: 319 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN 140 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN Sbjct: 1 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN 60 Query: 139 PQT 131 PQT Sbjct: 61 PQT 63 >YP_009330679.1 ATP synthase CF0 A subunit IV (chloroplast) [Viburnum utile] AII18534.1 ATPI synthase CF0 subunit IV, partial (chloroplast) [Viburnum amplificatum] AII18535.1 ATPI synthase CF0 subunit IV, partial (chloroplast) [Viburnum carlesii] AII18536.1 ATPI synthase CF0 subunit IV, partial (chloroplast) [Viburnum cassinoides] AII18537.1 ATPI synthase CF0 subunit IV, partial (chloroplast) [Viburnum clemensae] AII18539.1 ATPI synthase CF0 subunit IV, partial (chloroplast) [Viburnum dentatum] AII18543.1 ATPI synthase CF0 subunit IV, partial (chloroplast) [Viburnum lantanoides] AII18544.1 ATPI synthase CF0 subunit IV, partial (chloroplast) [Viburnum lentago] AII18545.1 ATPI synthase CF0 subunit IV, partial (chloroplast) [Viburnum lutescens] AII18546.1 ATPI synthase CF0 subunit IV, partial (chloroplast) [Viburnum molle] AII18547.1 ATPI synthase CF0 subunit IV, partial (chloroplast) [Viburnum opulus] AII18548.1 ATPI synthase CF0 subunit IV, partial (chloroplast) [Viburnum plicatum] AII18549.1 ATPI synthase CF0 subunit IV, partial (chloroplast) [Viburnum punctatum] AII18551.1 ATPI synthase CF0 subunit IV, partial (chloroplast) [Viburnum taiwanianum] AII18552.1 ATPI synthase CF0 subunit IV, partial (chloroplast) [Viburnum tinus] AII18553.1 ATPI synthase CF0 subunit IV, partial (chloroplast) [Viburnum triphyllum] APD79281.1 ATP synthase CF0 A subunit IV (chloroplast) [Viburnum utile] Length = 247 Score = 130 bits (327), Expect = 1e-33 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -2 Query: 319 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN 140 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN Sbjct: 1 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN 60 Query: 139 PQT 131 PQT Sbjct: 61 PQT 63 >AII18533.1 ATPI synthase CF0 subunit IV, partial (chloroplast) [Viburnum acerifolium] AII18538.1 ATPI synthase CF0 subunit IV, partial (chloroplast) [Viburnum cylindricum] AII18540.1 ATPI synthase CF0 subunit IV, partial (chloroplast) [Viburnum dilatatum] AII18541.1 ATPI synthase CF0 subunit IV, partial (chloroplast) [Viburnum erubescens] AII18542.1 ATPI synthase CF0 subunit IV, partial (chloroplast) [Viburnum grandiflorum] AII18550.1 ATPI synthase CF0 subunit IV, partial (chloroplast) [Viburnum sieboldii] Length = 247 Score = 130 bits (327), Expect = 1e-33 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -2 Query: 319 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN 140 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN Sbjct: 1 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN 60 Query: 139 PQT 131 PQT Sbjct: 61 PQT 63 >YP_009130949.1 ATP synthase CF0 A chain (chloroplast) [Lonicera japonica] ADD31545.1 ATP synthase CF0 subunit IV protein (chloroplast) [Lonicera japonica] AHN52966.1 ATP synthase CF0 A chain (chloroplast) [Lonicera japonica] AKZ21704.1 ATP synthase CF0 A subunit (plastid) [Symphoricarpos occidentalis] Length = 247 Score = 130 bits (327), Expect = 1e-33 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -2 Query: 319 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN 140 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN Sbjct: 1 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN 60 Query: 139 PQT 131 PQT Sbjct: 61 PQT 63 >ADD31541.1 ATP synthase CF0 subunit IV protein (chloroplast) [Aucuba japonica] Length = 247 Score = 130 bits (327), Expect = 1e-33 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -2 Query: 319 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN 140 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN Sbjct: 1 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN 60 Query: 139 PQT 131 PQT Sbjct: 61 PQT 63 >ADK89681.1 ATP synthase CF0 subunit IV (chloroplast) [Hydrocotyle verticillata] Length = 247 Score = 130 bits (327), Expect = 1e-33 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -2 Query: 319 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN 140 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN Sbjct: 1 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN 60 Query: 139 PQT 131 PQT Sbjct: 61 PQT 63 >YP_004935540.1 ATP synthase CF0 A subunit (chloroplast) [Eleutherococcus senticosus] YP_008814931.1 ATP synthase CF0 subunit IV (chloroplast) [Brassaiopsis hainla] YP_008815018.1 ATP synthase CF0 subunit IV (chloroplast) [Metapanax delavayi] YP_008814844.1 ATP synthase CF0 subunit IV (chloroplast) [Aralia undulata] YP_008815192.1 ATP synthase CF0 subunit IV (chloroplast) [Kalopanax septemlobus] YP_009121161.1 ATP synthase CF0 subunit IV (chloroplast) [Panax notoginseng] YP_009122713.1 ATP synthase CF0 A subunit (chloroplast) [Dendropanax dentiger] YP_009155416.1 atpI (chloroplast) [Panax quinquefolius] YP_009161667.1 ATP synthase CF0 subunit IV (chloroplast) [Fatsia japonica] YP_009191841.1 ATP synthase CF0 subunit IV (chloroplast) [Panax japonicus] AEO92606.1 ATP synthase CF0 A subunit (chloroplast) [Eleutherococcus senticosus] AGG38944.1 ATP synthase CF0 subunit IV (chloroplast) [Aralia undulata] AGG39031.1 ATP synthase CF0 subunit IV (chloroplast) [Brassaiopsis hainla] AGG39118.1 ATP synthase CF0 subunit IV (chloroplast) [Metapanax delavayi] AGG39292.1 ATP synthase CF0 subunit IV (chloroplast) [Kalopanax septemlobus] AGM14958.1 ATP synthase CF0 A subunit (chloroplast) [Panax ginseng] AGM15044.1 ATP synthase CF0 A subunit (chloroplast) [Panax ginseng] AGM15130.1 ATP synthase CF0 A subunit (chloroplast) [Panax ginseng] AGW31891.1 ATP synthase CF0 A subunit (chloroplast) [Panax ginseng] AIA24315.1 ATP synthase CF0 subunit IV (chloroplast) [Panax notoginseng] AIX97877.1 AtpI (chloroplast) [Panax ginseng] AIX97964.1 AtpI (chloroplast) [Panax ginseng] AIX98047.1 AtpI (chloroplast) [Panax ginseng] AIX98132.1 AtpI (chloroplast) [Panax ginseng] AIX98217.1 AtpI (chloroplast) [Panax ginseng] AIX98302.1 AtpI (chloroplast) [Panax ginseng] AIX98387.1 AtpI (chloroplast) [Panax ginseng] AIX98472.1 AtpI (chloroplast) [Panax ginseng] AIX98557.1 AtpI (chloroplast) [Panax ginseng] AJC99476.1 atpI (chloroplast) [Panax quinquefolius] AJC99561.1 atpI (chloroplast) [Panax ginseng] AJC99646.1 atpI (chloroplast) [Panax ginseng] AJK29877.1 ATP synthase CF0 A subunit (chloroplast) [Dendropanax dentiger] AKB99060.1 ATP synthase CF0 subunit IV (chloroplast) [Panax notoginseng] AKB99147.1 ATP synthase CF0 subunit IV (chloroplast) [Panax japonicus] AKG26588.1 ATP synthase CF0 A subunit (chloroplast) [Panax notoginseng] AKS10940.1 ATP synthase CF0 subunit IV (chloroplast) [Fatsia japonica] AKU70763.1 ATP synthase CF0 subunit IV (chloroplast) [Panax notoginseng] AKZ29734.1 ATP synthase CF0 subunit IV (chloroplast) [Panax quinquefolius] ALI89390.1 AtpI, partial (chloroplast) [Apodytes dimidiata] ANS71757.1 AtpI (chloroplast) [Eleutherococcus sessiliflorus] ANS71844.1 AtpI (chloroplast) [Eleutherococcus gracilistylus] ANS71931.1 AtpI (chloroplast) [Aralia elata] Length = 247 Score = 130 bits (327), Expect = 1e-33 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -2 Query: 319 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN 140 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN Sbjct: 1 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN 60 Query: 139 PQT 131 PQT Sbjct: 61 PQT 63 >YP_009255594.1 ATP synthase CF0 A subunit (chloroplast) [Cornus controversa] AND96917.1 ATP synthase CF0 A subunit (chloroplast) [Cornus controversa] Length = 247 Score = 129 bits (325), Expect = 2e-33 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = -2 Query: 319 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN 140 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSAT+AVRN Sbjct: 1 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATLAVRN 60 Query: 139 PQT 131 PQT Sbjct: 61 PQT 63 >ANS81189.1 ATP synthase CFO A subunit IV (chloroplast) [Ilex delavayi] Length = 247 Score = 129 bits (324), Expect = 3e-33 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = -2 Query: 319 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN 140 MNVL+CSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN Sbjct: 1 MNVLACSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN 60 Query: 139 PQT 131 PQT Sbjct: 61 PQT 63 >ADD31554.1 ATP synthase CF0 subunit IV protein (chloroplast) [Cornus florida] Length = 247 Score = 129 bits (324), Expect = 3e-33 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = -2 Query: 319 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN 140 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVV+AILLGSATIAVRN Sbjct: 1 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVMAILLGSATIAVRN 60 Query: 139 PQT 131 PQT Sbjct: 61 PQT 63 >ADD31544.1 ATP synthase CF0 subunit IV protein (chloroplast) [Ilex cornuta] ANS80714.1 ATP synthase CFO A subunit IV (chloroplast) [Ilex latifolia] ANS80809.1 ATP synthase CFO A subunit IV (chloroplast) [Ilex szechwanensis] ANS80904.1 ATP synthase CFO A subunit IV (chloroplast) [Ilex pubescens] ANS80999.1 ATP synthase CFO A subunit IV (chloroplast) [Ilex polyneura] ANS81094.1 ATP synthase CFO A subunit IV (chloroplast) [Ilex sp. XY-2016] ANS81284.1 ATP synthase CFO A subunit IV (chloroplast) [Ilex wilsonii] Length = 247 Score = 129 bits (324), Expect = 3e-33 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = -2 Query: 319 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN 140 MNVL+CSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN Sbjct: 1 MNVLACSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN 60 Query: 139 PQT 131 PQT Sbjct: 61 PQT 63 >YP_009336364.1 ATP synthase CF0 subunit IV (chloroplast) [Nicotiana otophora] ALT14459.1 ATP synthase CF0 subunit IV (chloroplast) [Nicotiana otophora] Length = 247 Score = 129 bits (323), Expect = 4e-33 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = -2 Query: 319 MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN 140 MNVLSCSINTLKGLYDISGVEVGQHFYW+IGGFQVHGQVLITSWVVIAILLGSATIAVRN Sbjct: 1 MNVLSCSINTLKGLYDISGVEVGQHFYWQIGGFQVHGQVLITSWVVIAILLGSATIAVRN 60 Query: 139 PQT 131 PQT Sbjct: 61 PQT 63