BLASTX nr result
ID: Panax24_contig00021568
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00021568 (529 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017215222.1 PREDICTED: ruvB-like 2 [Daucus carota subsp. sati... 55 1e-05 >XP_017215222.1 PREDICTED: ruvB-like 2 [Daucus carota subsp. sativus] KZM88739.1 hypothetical protein DCAR_025814 [Daucus carota subsp. sativus] Length = 467 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -1 Query: 529 LFLDIKRSTQYLMEFQSEYMFSEVAPVARDEGEDDAMNS 413 LF+D+KRSTQYLME+QSEYMFSE+ A D+ E AM+S Sbjct: 429 LFMDVKRSTQYLMEYQSEYMFSELQTSAADDDEAIAMSS 467