BLASTX nr result
ID: Panax24_contig00021190
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00021190 (420 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014491265.1 PREDICTED: regulation of nuclear pre-mRNA domain-... 60 7e-08 XP_017418323.1 PREDICTED: regulation of nuclear pre-mRNA domain-... 60 7e-08 XP_002267006.1 PREDICTED: regulation of nuclear pre-mRNA domain-... 59 1e-07 XP_018855850.1 PREDICTED: formin-like protein 20 isoform X2 [Jug... 57 7e-07 XP_018809786.1 PREDICTED: formin-like protein 20 isoform X1 [Jug... 57 7e-07 XP_018855849.1 PREDICTED: formin-like protein 20 isoform X1 [Jug... 57 7e-07 XP_018845860.1 PREDICTED: regulation of nuclear pre-mRNA domain-... 57 8e-07 XP_018812453.1 PREDICTED: regulation of nuclear pre-mRNA domain-... 57 1e-06 XP_018812452.1 PREDICTED: regulation of nuclear pre-mRNA domain-... 57 1e-06 XP_018812451.1 PREDICTED: formin-2-like isoform X2 [Juglans regia] 57 1e-06 XP_018812449.1 PREDICTED: formin-2-like isoform X1 [Juglans regia] 57 1e-06 XP_017253985.1 PREDICTED: regulation of nuclear pre-mRNA domain-... 56 2e-06 KZM93705.1 hypothetical protein DCAR_016950 [Daucus carota subsp... 56 2e-06 KZM99135.1 hypothetical protein DCAR_013503 [Daucus carota subsp... 56 2e-06 KYP64014.1 Regulation of nuclear pre-mRNA domain-containing prot... 56 2e-06 KHN34610.1 Regulation of nuclear pre-mRNA domain-containing prot... 56 2e-06 XP_006604284.1 PREDICTED: regulation of nuclear pre-mRNA domain-... 56 2e-06 XP_014627020.1 PREDICTED: regulation of nuclear pre-mRNA domain-... 56 2e-06 OAY41855.1 hypothetical protein MANES_09G134600 [Manihot esculenta] 56 2e-06 XP_017247875.1 PREDICTED: regulation of nuclear pre-mRNA domain-... 56 2e-06 >XP_014491265.1 PREDICTED: regulation of nuclear pre-mRNA domain-containing protein 2-like [Vigna radiata var. radiata] XP_014491267.1 PREDICTED: regulation of nuclear pre-mRNA domain-containing protein 2-like [Vigna radiata var. radiata] Length = 533 Score = 60.1 bits (144), Expect = 7e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 59 GGYYRPPGIGFYGQSHQATPPPVPRQ 136 GGYYRPPGIGFYGQSH +TPPPVPRQ Sbjct: 508 GGYYRPPGIGFYGQSHPSTPPPVPRQ 533 >XP_017418323.1 PREDICTED: regulation of nuclear pre-mRNA domain-containing protein 2-like [Vigna angularis] KOM38650.1 hypothetical protein LR48_Vigan03g203200 [Vigna angularis] BAT85018.1 hypothetical protein VIGAN_04250900 [Vigna angularis var. angularis] Length = 533 Score = 60.1 bits (144), Expect = 7e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 59 GGYYRPPGIGFYGQSHQATPPPVPRQ 136 GGYYRPPGIGFYGQSH +TPPPVPRQ Sbjct: 508 GGYYRPPGIGFYGQSHPSTPPPVPRQ 533 >XP_002267006.1 PREDICTED: regulation of nuclear pre-mRNA domain-containing protein 1B [Vitis vinifera] XP_010653148.1 PREDICTED: regulation of nuclear pre-mRNA domain-containing protein 1B [Vitis vinifera] Length = 562 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = +2 Query: 59 GGYYRPPGIGFYGQSHQATPPPVPRQ 136 GGYYRPPGI FYGQSHQ TPPPVPRQ Sbjct: 537 GGYYRPPGIAFYGQSHQPTPPPVPRQ 562 >XP_018855850.1 PREDICTED: formin-like protein 20 isoform X2 [Juglans regia] XP_018809787.1 PREDICTED: formin-like protein 20 isoform X2 [Juglans regia] Length = 303 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/26 (88%), Positives = 24/26 (92%) Frame = +2 Query: 59 GGYYRPPGIGFYGQSHQATPPPVPRQ 136 GG+YRP GIGFYGQSHQ TPPPVPRQ Sbjct: 278 GGFYRPAGIGFYGQSHQPTPPPVPRQ 303 >XP_018809786.1 PREDICTED: formin-like protein 20 isoform X1 [Juglans regia] Length = 307 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/26 (88%), Positives = 24/26 (92%) Frame = +2 Query: 59 GGYYRPPGIGFYGQSHQATPPPVPRQ 136 GG+YRP GIGFYGQSHQ TPPPVPRQ Sbjct: 282 GGFYRPAGIGFYGQSHQPTPPPVPRQ 307 >XP_018855849.1 PREDICTED: formin-like protein 20 isoform X1 [Juglans regia] Length = 307 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/26 (88%), Positives = 24/26 (92%) Frame = +2 Query: 59 GGYYRPPGIGFYGQSHQATPPPVPRQ 136 GG+YRP GIGFYGQSHQ TPPPVPRQ Sbjct: 282 GGFYRPAGIGFYGQSHQPTPPPVPRQ 307 >XP_018845860.1 PREDICTED: regulation of nuclear pre-mRNA domain-containing protein 1B-like [Juglans regia] Length = 567 Score = 57.0 bits (136), Expect = 8e-07 Identities = 23/26 (88%), Positives = 24/26 (92%) Frame = +2 Query: 59 GGYYRPPGIGFYGQSHQATPPPVPRQ 136 GG+YRP GIGFYGQSHQ TPPPVPRQ Sbjct: 542 GGFYRPAGIGFYGQSHQPTPPPVPRQ 567 >XP_018812453.1 PREDICTED: regulation of nuclear pre-mRNA domain-containing protein 2-like isoform X4 [Juglans regia] Length = 562 Score = 56.6 bits (135), Expect = 1e-06 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = +2 Query: 59 GGYYRPPGIGFYGQSHQATPPPVPRQ 136 GG+YRPPG+GFYGQSHQ T PPVPRQ Sbjct: 537 GGFYRPPGVGFYGQSHQPTTPPVPRQ 562 >XP_018812452.1 PREDICTED: regulation of nuclear pre-mRNA domain-containing protein 2-like isoform X3 [Juglans regia] Length = 581 Score = 56.6 bits (135), Expect = 1e-06 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = +2 Query: 59 GGYYRPPGIGFYGQSHQATPPPVPRQ 136 GG+YRPPG+GFYGQSHQ T PPVPRQ Sbjct: 556 GGFYRPPGVGFYGQSHQPTTPPVPRQ 581 >XP_018812451.1 PREDICTED: formin-2-like isoform X2 [Juglans regia] Length = 635 Score = 56.6 bits (135), Expect = 1e-06 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = +2 Query: 59 GGYYRPPGIGFYGQSHQATPPPVPRQ 136 GG+YRPPG+GFYGQSHQ T PPVPRQ Sbjct: 610 GGFYRPPGVGFYGQSHQPTTPPVPRQ 635 >XP_018812449.1 PREDICTED: formin-2-like isoform X1 [Juglans regia] Length = 637 Score = 56.6 bits (135), Expect = 1e-06 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = +2 Query: 59 GGYYRPPGIGFYGQSHQATPPPVPRQ 136 GG+YRPPG+GFYGQSHQ T PPVPRQ Sbjct: 612 GGFYRPPGVGFYGQSHQPTTPPVPRQ 637 >XP_017253985.1 PREDICTED: regulation of nuclear pre-mRNA domain-containing protein 1A-like [Daucus carota subsp. sativus] XP_017253986.1 PREDICTED: regulation of nuclear pre-mRNA domain-containing protein 1A-like [Daucus carota subsp. sativus] XP_017253987.1 PREDICTED: regulation of nuclear pre-mRNA domain-containing protein 1A-like [Daucus carota subsp. sativus] XP_017253989.1 PREDICTED: regulation of nuclear pre-mRNA domain-containing protein 1A-like [Daucus carota subsp. sativus] Length = 541 Score = 56.2 bits (134), Expect = 2e-06 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +2 Query: 56 NGGYYRPPGIGFYGQSHQATPPPVPRQ 136 NGGYYRPPGIGFYGQSHQ TPP RQ Sbjct: 515 NGGYYRPPGIGFYGQSHQPTPPSAQRQ 541 >KZM93705.1 hypothetical protein DCAR_016950 [Daucus carota subsp. sativus] Length = 544 Score = 56.2 bits (134), Expect = 2e-06 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +2 Query: 56 NGGYYRPPGIGFYGQSHQATPPPVPRQ 136 NGGYYRPPGIGFYGQSHQ TPP RQ Sbjct: 518 NGGYYRPPGIGFYGQSHQPTPPSAQRQ 544 >KZM99135.1 hypothetical protein DCAR_013503 [Daucus carota subsp. sativus] Length = 296 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/45 (55%), Positives = 26/45 (57%) Frame = +2 Query: 2 RPAXXXXXXXXXXXXXXXNGGYYRPPGIGFYGQSHQATPPPVPRQ 136 RPA N GYYRPPGIGFYGQ+HQ PPPV RQ Sbjct: 252 RPAPPPQLQQSQAQQQNNNSGYYRPPGIGFYGQNHQPAPPPVQRQ 296 >KYP64014.1 Regulation of nuclear pre-mRNA domain-containing protein 1B [Cajanus cajan] Length = 507 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/26 (84%), Positives = 25/26 (96%) Frame = +2 Query: 59 GGYYRPPGIGFYGQSHQATPPPVPRQ 136 GG+YRPPGIGFYGQS+ +TPPPVPRQ Sbjct: 482 GGFYRPPGIGFYGQSNPSTPPPVPRQ 507 >KHN34610.1 Regulation of nuclear pre-mRNA domain-containing protein 1B [Glycine soja] Length = 519 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = +2 Query: 62 GYYRPPGIGFYGQSHQATPPPVPRQ 136 G+YRPPGIGFYGQSH +TPPPVPRQ Sbjct: 495 GFYRPPGIGFYGQSHLSTPPPVPRQ 519 >XP_006604284.1 PREDICTED: regulation of nuclear pre-mRNA domain-containing protein 1A-like isoform X2 [Glycine max] KRG94958.1 hypothetical protein GLYMA_19G121100 [Glycine max] KRG94959.1 hypothetical protein GLYMA_19G121100 [Glycine max] KRG94960.1 hypothetical protein GLYMA_19G121100 [Glycine max] KRG94961.1 hypothetical protein GLYMA_19G121100 [Glycine max] Length = 527 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = +2 Query: 62 GYYRPPGIGFYGQSHQATPPPVPRQ 136 G+YRPPGIGFYGQSH +TPPPVPRQ Sbjct: 503 GFYRPPGIGFYGQSHLSTPPPVPRQ 527 >XP_014627020.1 PREDICTED: regulation of nuclear pre-mRNA domain-containing protein 1A-like isoform X1 [Glycine max] XP_014627021.1 PREDICTED: regulation of nuclear pre-mRNA domain-containing protein 1A-like isoform X1 [Glycine max] XP_014627022.1 PREDICTED: regulation of nuclear pre-mRNA domain-containing protein 1A-like isoform X1 [Glycine max] XP_014627023.1 PREDICTED: regulation of nuclear pre-mRNA domain-containing protein 1A-like isoform X1 [Glycine max] Length = 533 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = +2 Query: 62 GYYRPPGIGFYGQSHQATPPPVPRQ 136 G+YRPPGIGFYGQSH +TPPPVPRQ Sbjct: 509 GFYRPPGIGFYGQSHLSTPPPVPRQ 533 >OAY41855.1 hypothetical protein MANES_09G134600 [Manihot esculenta] Length = 541 Score = 55.8 bits (133), Expect = 2e-06 Identities = 21/26 (80%), Positives = 24/26 (92%) Frame = +2 Query: 59 GGYYRPPGIGFYGQSHQATPPPVPRQ 136 GGYYRPPG+GFYGQ+HQ+ PPVPRQ Sbjct: 516 GGYYRPPGVGFYGQNHQSATPPVPRQ 541 >XP_017247875.1 PREDICTED: regulation of nuclear pre-mRNA domain-containing protein 1B-like [Daucus carota subsp. sativus] Length = 546 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/45 (55%), Positives = 26/45 (57%) Frame = +2 Query: 2 RPAXXXXXXXXXXXXXXXNGGYYRPPGIGFYGQSHQATPPPVPRQ 136 RPA N GYYRPPGIGFYGQ+HQ PPPV RQ Sbjct: 502 RPAPPPQLQQSQAQQQNNNSGYYRPPGIGFYGQNHQPAPPPVQRQ 546