BLASTX nr result
ID: Panax24_contig00021166
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00021166 (489 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009776250.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 4e-08 XP_009602545.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 1e-07 XP_009602546.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 1e-07 XP_017253703.1 PREDICTED: pentatricopeptide repeat-containing pr... 54 1e-07 XP_019239264.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 6e-07 OIT21153.1 pentatricopeptide repeat-containing protein, chloropl... 57 6e-07 XP_012831937.1 PREDICTED: pentatricopeptide repeat-containing pr... 49 4e-06 >XP_009776250.1 PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic [Nicotiana sylvestris] XP_016463308.1 PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic-like [Nicotiana tabacum] Length = 857 Score = 60.5 bits (145), Expect(2) = 4e-08 Identities = 27/52 (51%), Positives = 43/52 (82%) Frame = +3 Query: 204 VKPSQFVALLNSELVSMGVVEMVEKGEIRRLVDALSGAQKLGIGPLELFGGA 359 V ++F ALLN+++VS G+V ++E+G+++ +V+ L+GAQKLGI PL+LF GA Sbjct: 104 VNAAEFAALLNAKIVSDGIVRLLEEGKLKSVVELLTGAQKLGIEPLKLFDGA 155 Score = 24.3 bits (51), Expect(2) = 4e-08 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +2 Query: 377 RECCLIVKRGEVEELVDLMGIL 442 REC ++ GE+EE+V LM L Sbjct: 162 RECRRTMECGEIEEVVSLMETL 183 >XP_009602545.1 PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X1 [Nicotiana tomentosiformis] XP_016469097.1 PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic-like isoform X1 [Nicotiana tabacum] Length = 856 Score = 59.3 bits (142), Expect(2) = 1e-07 Identities = 27/52 (51%), Positives = 42/52 (80%) Frame = +3 Query: 204 VKPSQFVALLNSELVSMGVVEMVEKGEIRRLVDALSGAQKLGIGPLELFGGA 359 V ++F ALLN+++VS G+V ++E+G++R +V+ L+GAQKLGI PL+L GA Sbjct: 96 VNAAEFAALLNAKIVSDGIVRLLEEGKLRSVVELLTGAQKLGIEPLKLLDGA 147 Score = 23.5 bits (49), Expect(2) = 1e-07 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 377 RECCLIVKRGEVEELVDLMGIL 442 REC ++ GE+EE V LM L Sbjct: 154 RECRRTMECGEIEEAVSLMETL 175 >XP_009602546.1 PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X2 [Nicotiana tomentosiformis] XP_016469098.1 PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic-like isoform X2 [Nicotiana tabacum] Length = 849 Score = 59.3 bits (142), Expect(2) = 1e-07 Identities = 27/52 (51%), Positives = 42/52 (80%) Frame = +3 Query: 204 VKPSQFVALLNSELVSMGVVEMVEKGEIRRLVDALSGAQKLGIGPLELFGGA 359 V ++F ALLN+++VS G+V ++E+G++R +V+ L+GAQKLGI PL+L GA Sbjct: 96 VNAAEFAALLNAKIVSDGIVRLLEEGKLRSVVELLTGAQKLGIEPLKLLDGA 147 Score = 23.5 bits (49), Expect(2) = 1e-07 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 377 RECCLIVKRGEVEELVDLMGIL 442 REC ++ GE+EE V LM L Sbjct: 154 RECRRTMECGEIEEAVSLMETL 175 >XP_017253703.1 PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic [Daucus carota subsp. sativus] KZM94478.1 hypothetical protein DCAR_017721 [Daucus carota subsp. sativus] Length = 827 Score = 53.5 bits (127), Expect(2) = 1e-07 Identities = 25/49 (51%), Positives = 34/49 (69%) Frame = +3 Query: 204 VKPSQFVALLNSELVSMGVVEMVEKGEIRRLVDALSGAQKLGIGPLELF 350 VK S F L+N +LVS G++ M+ G++ R+V LSGAQKLG+ ELF Sbjct: 88 VKVSDFANLINVDLVSKGLIRMLRSGDVERVVQVLSGAQKLGLSVAELF 136 Score = 29.3 bits (64), Expect(2) = 1e-07 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +2 Query: 377 RECCLIVKRGEVEELVDLMGIL 442 +EC L+ +RG VE +VDL+ +L Sbjct: 146 KECSLVAERGNVEAVVDLLEVL 167 >XP_019239264.1 PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic [Nicotiana attenuata] Length = 903 Score = 57.4 bits (137), Expect(2) = 6e-07 Identities = 26/52 (50%), Positives = 41/52 (78%) Frame = +3 Query: 204 VKPSQFVALLNSELVSMGVVEMVEKGEIRRLVDALSGAQKLGIGPLELFGGA 359 V ++F ALLN+++VS G+V ++E+G++R +V+ L+GA KLGI PL+L GA Sbjct: 140 VNAAEFAALLNAKIVSDGIVRLLEEGKLRSVVELLTGAHKLGIEPLKLLDGA 191 Score = 23.1 bits (48), Expect(2) = 6e-07 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +2 Query: 377 RECCLIVKRGEVEELVDLMGIL 442 REC ++ G++EE+V LM L Sbjct: 198 RECKRTMECGDIEEVVSLMETL 219 >OIT21153.1 pentatricopeptide repeat-containing protein, chloroplastic [Nicotiana attenuata] Length = 867 Score = 57.4 bits (137), Expect(2) = 6e-07 Identities = 26/52 (50%), Positives = 41/52 (78%) Frame = +3 Query: 204 VKPSQFVALLNSELVSMGVVEMVEKGEIRRLVDALSGAQKLGIGPLELFGGA 359 V ++F ALLN+++VS G+V ++E+G++R +V+ L+GA KLGI PL+L GA Sbjct: 104 VNAAEFAALLNAKIVSDGIVRLLEEGKLRSVVELLTGAHKLGIEPLKLLDGA 155 Score = 23.1 bits (48), Expect(2) = 6e-07 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +2 Query: 377 RECCLIVKRGEVEELVDLMGIL 442 REC ++ G++EE+V LM L Sbjct: 162 RECKRTMECGDIEEVVSLMETL 183 >XP_012831937.1 PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic [Erythranthe guttata] EYU41644.1 hypothetical protein MIMGU_mgv1a001284mg [Erythranthe guttata] Length = 847 Score = 48.9 bits (115), Expect(2) = 4e-06 Identities = 24/56 (42%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = +3 Query: 186 VSSGRIVKPSQFVALLNSELVSMGVVEMVEKGEIRRLVDAL-SGAQKLGIGPLELF 350 V+SG VKPS+F+ALLN++ V++GV ++++G + +V L +G +K+GI P+++F Sbjct: 97 VASG--VKPSEFLALLNAKCVAIGVARVLDEGNLHSVVKMLFNGLEKIGIDPVQMF 150 Score = 28.9 bits (63), Expect(2) = 4e-06 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = +2 Query: 377 RECCLIVKRGEVEELVDLMGIL 442 REC ++KRGEVE+LV M L Sbjct: 160 RECRRLLKRGEVEQLVSFMETL 181