BLASTX nr result
ID: Panax24_contig00021074
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00021074 (439 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP09482.1 unnamed protein product [Coffea canephora] 84 6e-16 KNA22767.1 hypothetical protein SOVF_031520 isoform A [Spinacia ... 82 2e-15 KNA22768.1 hypothetical protein SOVF_031520 isoform B [Spinacia ... 82 2e-15 XP_016709759.1 PREDICTED: CCR4-NOT transcription complex subunit... 82 3e-15 KJB41044.1 hypothetical protein B456_007G0881001, partial [Gossy... 81 4e-15 KJB41046.1 hypothetical protein B456_007G0881001, partial [Gossy... 81 4e-15 KJB41042.1 hypothetical protein B456_007G0881001, partial [Gossy... 81 4e-15 KHG29327.1 CCR4-NOT transcription complex subunit 1 [Gossypium a... 81 4e-15 KJB49218.1 hypothetical protein B456_008G107100 [Gossypium raimo... 81 4e-15 XP_017615350.1 PREDICTED: CCR4-NOT transcription complex subunit... 81 4e-15 XP_012489730.1 PREDICTED: CCR4-NOT transcription complex subunit... 81 4e-15 XP_016695351.1 PREDICTED: CCR4-NOT transcription complex subunit... 81 4e-15 XP_016694962.1 PREDICTED: CCR4-NOT transcription complex subunit... 81 4e-15 XP_018820083.1 PREDICTED: CCR4-NOT transcription complex subunit... 81 4e-15 XP_017615349.1 PREDICTED: CCR4-NOT transcription complex subunit... 81 4e-15 XP_016694961.1 PREDICTED: CCR4-NOT transcription complex subunit... 81 4e-15 XP_012489729.1 PREDICTED: CCR4-NOT transcription complex subunit... 81 4e-15 XP_016695350.1 PREDICTED: CCR4-NOT transcription complex subunit... 81 4e-15 XP_018820079.1 PREDICTED: CCR4-NOT transcription complex subunit... 81 4e-15 KJB49217.1 hypothetical protein B456_008G107100 [Gossypium raimo... 81 4e-15 >CDP09482.1 unnamed protein product [Coffea canephora] Length = 2422 Score = 83.6 bits (205), Expect = 6e-16 Identities = 41/48 (85%), Positives = 45/48 (93%) Frame = +2 Query: 167 C*EPLRGSITSQVRNSLQGLNIGSELIEQSVLLVTNDNLDLGCALIEQ 310 C EPLR SI+SQ+RNSLQGLNI SEL+EQ+VLLVTNDNLDLGCALIEQ Sbjct: 1388 CKEPLRASISSQLRNSLQGLNIASELLEQAVLLVTNDNLDLGCALIEQ 1435 >KNA22767.1 hypothetical protein SOVF_031520 isoform A [Spinacia oleracea] Length = 2377 Score = 82.4 bits (202), Expect = 2e-15 Identities = 39/53 (73%), Positives = 46/53 (86%) Frame = +2 Query: 167 C*EPLRGSITSQVRNSLQGLNIGSELIEQSVLLVTNDNLDLGCALIEQVQQRR 325 C EPLRGSI+SQ+RN LQG+NIGSE++EQ V LVTNDNLDLGCA+IEQ Q + Sbjct: 1345 CKEPLRGSISSQLRNMLQGVNIGSEILEQYVQLVTNDNLDLGCAMIEQAAQEK 1397 >KNA22768.1 hypothetical protein SOVF_031520 isoform B [Spinacia oleracea] Length = 2378 Score = 82.4 bits (202), Expect = 2e-15 Identities = 39/53 (73%), Positives = 46/53 (86%) Frame = +2 Query: 167 C*EPLRGSITSQVRNSLQGLNIGSELIEQSVLLVTNDNLDLGCALIEQVQQRR 325 C EPLRGSI+SQ+RN LQG+NIGSE++EQ V LVTNDNLDLGCA+IEQ Q + Sbjct: 1345 CKEPLRGSISSQLRNMLQGVNIGSEILEQYVQLVTNDNLDLGCAMIEQAAQEK 1397 >XP_016709759.1 PREDICTED: CCR4-NOT transcription complex subunit 1-like [Gossypium hirsutum] Length = 2413 Score = 81.6 bits (200), Expect = 3e-15 Identities = 38/50 (76%), Positives = 47/50 (94%) Frame = +2 Query: 167 C*EPLRGSITSQVRNSLQGLNIGSELIEQSVLLVTNDNLDLGCALIEQVQ 316 C EPLRGSI+SQ+R+SLQGLN+GS+L+EQ+V LVTNDNLDLGCA+IEQ + Sbjct: 1377 CKEPLRGSISSQLRSSLQGLNVGSDLLEQAVQLVTNDNLDLGCAVIEQAR 1426 >KJB41044.1 hypothetical protein B456_007G0881001, partial [Gossypium raimondii] Length = 1719 Score = 81.3 bits (199), Expect = 4e-15 Identities = 38/48 (79%), Positives = 46/48 (95%) Frame = +2 Query: 167 C*EPLRGSITSQVRNSLQGLNIGSELIEQSVLLVTNDNLDLGCALIEQ 310 C EPLRGSI+SQ+RNSLQGL++GS+L+EQ+V LVTNDNLDLGCA+IEQ Sbjct: 759 CKEPLRGSISSQLRNSLQGLSVGSDLLEQAVQLVTNDNLDLGCAVIEQ 806 >KJB41046.1 hypothetical protein B456_007G0881001, partial [Gossypium raimondii] Length = 1788 Score = 81.3 bits (199), Expect = 4e-15 Identities = 38/48 (79%), Positives = 46/48 (95%) Frame = +2 Query: 167 C*EPLRGSITSQVRNSLQGLNIGSELIEQSVLLVTNDNLDLGCALIEQ 310 C EPLRGSI+SQ+RNSLQGL++GS+L+EQ+V LVTNDNLDLGCA+IEQ Sbjct: 752 CKEPLRGSISSQLRNSLQGLSVGSDLLEQAVQLVTNDNLDLGCAVIEQ 799 >KJB41042.1 hypothetical protein B456_007G0881001, partial [Gossypium raimondii] KJB41043.1 hypothetical protein B456_007G0881001, partial [Gossypium raimondii] KJB41045.1 hypothetical protein B456_007G0881001, partial [Gossypium raimondii] Length = 1795 Score = 81.3 bits (199), Expect = 4e-15 Identities = 38/48 (79%), Positives = 46/48 (95%) Frame = +2 Query: 167 C*EPLRGSITSQVRNSLQGLNIGSELIEQSVLLVTNDNLDLGCALIEQ 310 C EPLRGSI+SQ+RNSLQGL++GS+L+EQ+V LVTNDNLDLGCA+IEQ Sbjct: 759 CKEPLRGSISSQLRNSLQGLSVGSDLLEQAVQLVTNDNLDLGCAVIEQ 806 >KHG29327.1 CCR4-NOT transcription complex subunit 1 [Gossypium arboreum] Length = 2286 Score = 81.3 bits (199), Expect = 4e-15 Identities = 38/48 (79%), Positives = 46/48 (95%) Frame = +2 Query: 167 C*EPLRGSITSQVRNSLQGLNIGSELIEQSVLLVTNDNLDLGCALIEQ 310 C EPLRGSI+SQ+RNSLQGL++GS+L+EQ+V LVTNDNLDLGCA+IEQ Sbjct: 1306 CKEPLRGSISSQLRNSLQGLSVGSDLLEQAVQLVTNDNLDLGCAVIEQ 1353 >KJB49218.1 hypothetical protein B456_008G107100 [Gossypium raimondii] Length = 2290 Score = 81.3 bits (199), Expect = 4e-15 Identities = 38/48 (79%), Positives = 46/48 (95%) Frame = +2 Query: 167 C*EPLRGSITSQVRNSLQGLNIGSELIEQSVLLVTNDNLDLGCALIEQ 310 C EPLRGSI+SQ+R+SLQGLN+GS+L+EQ+V LVTNDNLDLGCA+IEQ Sbjct: 1377 CKEPLRGSISSQLRSSLQGLNVGSDLLEQAVQLVTNDNLDLGCAVIEQ 1424 >XP_017615350.1 PREDICTED: CCR4-NOT transcription complex subunit 1-like isoform X4 [Gossypium arboreum] Length = 2338 Score = 81.3 bits (199), Expect = 4e-15 Identities = 38/48 (79%), Positives = 46/48 (95%) Frame = +2 Query: 167 C*EPLRGSITSQVRNSLQGLNIGSELIEQSVLLVTNDNLDLGCALIEQ 310 C EPLRGSI+SQ+RNSLQGL++GS+L+EQ+V LVTNDNLDLGCA+IEQ Sbjct: 1302 CKEPLRGSISSQLRNSLQGLSVGSDLLEQAVQLVTNDNLDLGCAVIEQ 1349 >XP_012489730.1 PREDICTED: CCR4-NOT transcription complex subunit 1-like isoform X4 [Gossypium raimondii] Length = 2338 Score = 81.3 bits (199), Expect = 4e-15 Identities = 38/48 (79%), Positives = 46/48 (95%) Frame = +2 Query: 167 C*EPLRGSITSQVRNSLQGLNIGSELIEQSVLLVTNDNLDLGCALIEQ 310 C EPLRGSI+SQ+RNSLQGL++GS+L+EQ+V LVTNDNLDLGCA+IEQ Sbjct: 1302 CKEPLRGSISSQLRNSLQGLSVGSDLLEQAVQLVTNDNLDLGCAVIEQ 1349 >XP_016695351.1 PREDICTED: CCR4-NOT transcription complex subunit 1-like isoform X5 [Gossypium hirsutum] Length = 2339 Score = 81.3 bits (199), Expect = 4e-15 Identities = 38/48 (79%), Positives = 46/48 (95%) Frame = +2 Query: 167 C*EPLRGSITSQVRNSLQGLNIGSELIEQSVLLVTNDNLDLGCALIEQ 310 C EPLRGSI+SQ+RNSLQGL++GS+L+EQ+V LVTNDNLDLGCA+IEQ Sbjct: 1302 CKEPLRGSISSQLRNSLQGLSVGSDLLEQAVQLVTNDNLDLGCAVIEQ 1349 >XP_016694962.1 PREDICTED: CCR4-NOT transcription complex subunit 1-like isoform X5 [Gossypium hirsutum] Length = 2377 Score = 81.3 bits (199), Expect = 4e-15 Identities = 38/48 (79%), Positives = 46/48 (95%) Frame = +2 Query: 167 C*EPLRGSITSQVRNSLQGLNIGSELIEQSVLLVTNDNLDLGCALIEQ 310 C EPLRGSI+SQ+RNSLQGL++GS+L+EQ+V LVTNDNLDLGCA+IEQ Sbjct: 1378 CKEPLRGSISSQLRNSLQGLSVGSDLLEQAVQLVTNDNLDLGCAVIEQ 1425 >XP_018820083.1 PREDICTED: CCR4-NOT transcription complex subunit 1-like isoform X2 [Juglans regia] Length = 2404 Score = 81.3 bits (199), Expect = 4e-15 Identities = 39/48 (81%), Positives = 45/48 (93%) Frame = +2 Query: 167 C*EPLRGSITSQVRNSLQGLNIGSELIEQSVLLVTNDNLDLGCALIEQ 310 C EPLRGSI+SQ+RNSLQGLNI +EL+EQ+V LVTNDNLDLGCA+IEQ Sbjct: 1371 CKEPLRGSISSQLRNSLQGLNIANELLEQAVQLVTNDNLDLGCAVIEQ 1418 >XP_017615349.1 PREDICTED: CCR4-NOT transcription complex subunit 1-like isoform X3 [Gossypium arboreum] Length = 2407 Score = 81.3 bits (199), Expect = 4e-15 Identities = 38/48 (79%), Positives = 46/48 (95%) Frame = +2 Query: 167 C*EPLRGSITSQVRNSLQGLNIGSELIEQSVLLVTNDNLDLGCALIEQ 310 C EPLRGSI+SQ+RNSLQGL++GS+L+EQ+V LVTNDNLDLGCA+IEQ Sbjct: 1371 CKEPLRGSISSQLRNSLQGLSVGSDLLEQAVQLVTNDNLDLGCAVIEQ 1418 >XP_016694961.1 PREDICTED: CCR4-NOT transcription complex subunit 1-like isoform X4 [Gossypium hirsutum] Length = 2407 Score = 81.3 bits (199), Expect = 4e-15 Identities = 38/48 (79%), Positives = 46/48 (95%) Frame = +2 Query: 167 C*EPLRGSITSQVRNSLQGLNIGSELIEQSVLLVTNDNLDLGCALIEQ 310 C EPLRGSI+SQ+RNSLQGL++GS+L+EQ+V LVTNDNLDLGCA+IEQ Sbjct: 1371 CKEPLRGSISSQLRNSLQGLSVGSDLLEQAVQLVTNDNLDLGCAVIEQ 1418 >XP_012489729.1 PREDICTED: CCR4-NOT transcription complex subunit 1-like isoform X3 [Gossypium raimondii] Length = 2407 Score = 81.3 bits (199), Expect = 4e-15 Identities = 38/48 (79%), Positives = 46/48 (95%) Frame = +2 Query: 167 C*EPLRGSITSQVRNSLQGLNIGSELIEQSVLLVTNDNLDLGCALIEQ 310 C EPLRGSI+SQ+RNSLQGL++GS+L+EQ+V LVTNDNLDLGCA+IEQ Sbjct: 1371 CKEPLRGSISSQLRNSLQGLSVGSDLLEQAVQLVTNDNLDLGCAVIEQ 1418 >XP_016695350.1 PREDICTED: CCR4-NOT transcription complex subunit 1-like isoform X4 [Gossypium hirsutum] Length = 2408 Score = 81.3 bits (199), Expect = 4e-15 Identities = 38/48 (79%), Positives = 46/48 (95%) Frame = +2 Query: 167 C*EPLRGSITSQVRNSLQGLNIGSELIEQSVLLVTNDNLDLGCALIEQ 310 C EPLRGSI+SQ+RNSLQGL++GS+L+EQ+V LVTNDNLDLGCA+IEQ Sbjct: 1371 CKEPLRGSISSQLRNSLQGLSVGSDLLEQAVQLVTNDNLDLGCAVIEQ 1418 >XP_018820079.1 PREDICTED: CCR4-NOT transcription complex subunit 1-like isoform X1 [Juglans regia] Length = 2410 Score = 81.3 bits (199), Expect = 4e-15 Identities = 39/48 (81%), Positives = 45/48 (93%) Frame = +2 Query: 167 C*EPLRGSITSQVRNSLQGLNIGSELIEQSVLLVTNDNLDLGCALIEQ 310 C EPLRGSI+SQ+RNSLQGLNI +EL+EQ+V LVTNDNLDLGCA+IEQ Sbjct: 1377 CKEPLRGSISSQLRNSLQGLNIANELLEQAVQLVTNDNLDLGCAVIEQ 1424 >KJB49217.1 hypothetical protein B456_008G107100 [Gossypium raimondii] Length = 2411 Score = 81.3 bits (199), Expect = 4e-15 Identities = 38/48 (79%), Positives = 46/48 (95%) Frame = +2 Query: 167 C*EPLRGSITSQVRNSLQGLNIGSELIEQSVLLVTNDNLDLGCALIEQ 310 C EPLRGSI+SQ+R+SLQGLN+GS+L+EQ+V LVTNDNLDLGCA+IEQ Sbjct: 1377 CKEPLRGSISSQLRSSLQGLNVGSDLLEQAVQLVTNDNLDLGCAVIEQ 1424