BLASTX nr result
ID: Panax24_contig00020407
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00020407 (377 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016572781.1 PREDICTED: uncharacterized protein LOC107870691 [... 55 2e-06 >XP_016572781.1 PREDICTED: uncharacterized protein LOC107870691 [Capsicum annuum] Length = 238 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/32 (62%), Positives = 25/32 (78%) Frame = -1 Query: 374 GGTSSSEGVHQWQQHCMVSQLPQNASPPIFWF 279 G + +EG+H WQQHCM +QLPQN SPPI W+ Sbjct: 206 GAVNVNEGLHHWQQHCMTTQLPQNTSPPIAWY 237