BLASTX nr result
ID: Panax24_contig00020341
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00020341 (588 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017244785.1 PREDICTED: vestitone reductase-like [Daucus carot... 68 5e-10 XP_015874430.1 PREDICTED: 14-3-3-like protein D isoform X2 [Zizi... 61 9e-08 XP_015874421.1 PREDICTED: 14-3-3-like protein D isoform X1 [Zizi... 61 9e-08 KVI02208.1 14-3-3 domain-containing protein [Cynara cardunculus ... 60 1e-07 XP_006370162.1 hypothetical protein POPTR_0001s40270g [Populus t... 60 1e-07 XP_009406238.1 PREDICTED: 14-3-3-like protein C [Musa acuminata ... 60 1e-07 XP_002316863.1 14-3-3 brain family protein [Populus trichocarpa]... 60 1e-07 XP_006370161.1 14-3-3 brain family protein [Populus trichocarpa]... 60 1e-07 AAD27824.2 14-3-3 protein [Populus tremula x Populus alba] 60 1e-07 XP_018686442.1 PREDICTED: 14-3-3-like protein B isoform X2 [Musa... 60 1e-07 GAV60159.1 14-3-3 domain-containing protein [Cephalotus follicul... 60 1e-07 XP_009416512.1 PREDICTED: 14-3-3 protein 9-like isoform X2 [Musa... 60 1e-07 XP_009415239.1 PREDICTED: 14-3-3-like protein B isoform X1 [Musa... 60 1e-07 XP_009416511.1 PREDICTED: 14-3-3 protein 9-like isoform X1 [Musa... 60 1e-07 AKA21457.1 14-3-3f protein [Morus alba var. atropurpurea] 60 1e-07 XP_006370163.1 hypothetical protein POPTR_0001s40270g [Populus t... 60 1e-07 XP_006370164.1 hypothetical protein POPTR_0001s40270g [Populus t... 60 1e-07 KVI10474.1 14-3-3 domain-containing protein [Cynara cardunculus ... 60 2e-07 NP_001296639.1 14-3-3-like protein C [Cicer arietinum] ABQ95991.... 60 2e-07 XP_017256844.1 PREDICTED: 14-3-3-like protein C [Daucus carota s... 60 2e-07 >XP_017244785.1 PREDICTED: vestitone reductase-like [Daucus carota subsp. sativus] Length = 325 Score = 67.8 bits (164), Expect = 5e-10 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 1/47 (2%) Frame = +1 Query: 97 FLKQVVKDSKYFGFSTEKL-DTRFKYKYGLEEIYDEAVQCCKQKGLL 234 FLK V KDSK F S++KL DT FKYKYGLEE+YD+A++CCKQKGLL Sbjct: 280 FLKNV-KDSKIFRLSSKKLLDTGFKYKYGLEEMYDDAIECCKQKGLL 325 >XP_015874430.1 PREDICTED: 14-3-3-like protein D isoform X2 [Ziziphus jujuba] Length = 261 Score = 60.8 bits (146), Expect = 9e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 3 EMVDAMKKLAKLDVELTIEERNLLSVGYKNV 95 EMVDAMKK+AKLDVELTIEERNLLSVGYKNV Sbjct: 25 EMVDAMKKVAKLDVELTIEERNLLSVGYKNV 55 >XP_015874421.1 PREDICTED: 14-3-3-like protein D isoform X1 [Ziziphus jujuba] Length = 262 Score = 60.8 bits (146), Expect = 9e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 3 EMVDAMKKLAKLDVELTIEERNLLSVGYKNV 95 EMVDAMKK+AKLDVELTIEERNLLSVGYKNV Sbjct: 25 EMVDAMKKVAKLDVELTIEERNLLSVGYKNV 55 >KVI02208.1 14-3-3 domain-containing protein [Cynara cardunculus var. scolymus] Length = 258 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 3 EMVDAMKKLAKLDVELTIEERNLLSVGYKNV 95 EMVDAMKK+AKLDVELT+EERNLLSVGYKNV Sbjct: 25 EMVDAMKKVAKLDVELTVEERNLLSVGYKNV 55 >XP_006370162.1 hypothetical protein POPTR_0001s40270g [Populus trichocarpa] XP_011006524.1 PREDICTED: 14-3-3-like protein D isoform X2 [Populus euphratica] ERP66731.1 hypothetical protein POPTR_0001s40270g [Populus trichocarpa] Length = 259 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 3 EMVDAMKKLAKLDVELTIEERNLLSVGYKNV 95 EMVDAMKK+AKLDVELT+EERNLLSVGYKNV Sbjct: 25 EMVDAMKKVAKLDVELTVEERNLLSVGYKNV 55 >XP_009406238.1 PREDICTED: 14-3-3-like protein C [Musa acuminata subsp. malaccensis] Length = 260 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 3 EMVDAMKKLAKLDVELTIEERNLLSVGYKNV 95 EMVDAMKK+AKLDVELT+EERNLLSVGYKNV Sbjct: 25 EMVDAMKKVAKLDVELTVEERNLLSVGYKNV 55 >XP_002316863.1 14-3-3 brain family protein [Populus trichocarpa] EEE97475.1 14-3-3 brain family protein [Populus trichocarpa] Length = 260 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 3 EMVDAMKKLAKLDVELTIEERNLLSVGYKNV 95 EMVDAMKK+AKLDVELT+EERNLLSVGYKNV Sbjct: 25 EMVDAMKKVAKLDVELTVEERNLLSVGYKNV 55 >XP_006370161.1 14-3-3 brain family protein [Populus trichocarpa] XP_011006523.1 PREDICTED: 14-3-3-like protein D isoform X1 [Populus euphratica] AAF76227.1 14-3-3 protein [Populus tremula x Populus alba] ERP66730.1 14-3-3 brain family protein [Populus trichocarpa] Length = 260 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 3 EMVDAMKKLAKLDVELTIEERNLLSVGYKNV 95 EMVDAMKK+AKLDVELT+EERNLLSVGYKNV Sbjct: 25 EMVDAMKKVAKLDVELTVEERNLLSVGYKNV 55 >AAD27824.2 14-3-3 protein [Populus tremula x Populus alba] Length = 260 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 3 EMVDAMKKLAKLDVELTIEERNLLSVGYKNV 95 EMVDAMKK+AKLDVELT+EERNLLSVGYKNV Sbjct: 25 EMVDAMKKVAKLDVELTVEERNLLSVGYKNV 55 >XP_018686442.1 PREDICTED: 14-3-3-like protein B isoform X2 [Musa acuminata subsp. malaccensis] Length = 261 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 3 EMVDAMKKLAKLDVELTIEERNLLSVGYKNV 95 EMVDAMKK+AKLDVELT+EERNLLSVGYKNV Sbjct: 25 EMVDAMKKVAKLDVELTVEERNLLSVGYKNV 55 >GAV60159.1 14-3-3 domain-containing protein [Cephalotus follicularis] Length = 262 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 3 EMVDAMKKLAKLDVELTIEERNLLSVGYKNV 95 EMVDAMKK+AKLDVELT+EERNLLSVGYKNV Sbjct: 25 EMVDAMKKVAKLDVELTVEERNLLSVGYKNV 55 >XP_009416512.1 PREDICTED: 14-3-3 protein 9-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 262 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 3 EMVDAMKKLAKLDVELTIEERNLLSVGYKNV 95 EMVDAMKK+AKLDVELT+EERNLLSVGYKNV Sbjct: 25 EMVDAMKKVAKLDVELTVEERNLLSVGYKNV 55 >XP_009415239.1 PREDICTED: 14-3-3-like protein B isoform X1 [Musa acuminata subsp. malaccensis] Length = 262 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 3 EMVDAMKKLAKLDVELTIEERNLLSVGYKNV 95 EMVDAMKK+AKLDVELT+EERNLLSVGYKNV Sbjct: 25 EMVDAMKKVAKLDVELTVEERNLLSVGYKNV 55 >XP_009416511.1 PREDICTED: 14-3-3 protein 9-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 263 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 3 EMVDAMKKLAKLDVELTIEERNLLSVGYKNV 95 EMVDAMKK+AKLDVELT+EERNLLSVGYKNV Sbjct: 25 EMVDAMKKVAKLDVELTVEERNLLSVGYKNV 55 >AKA21457.1 14-3-3f protein [Morus alba var. atropurpurea] Length = 265 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 3 EMVDAMKKLAKLDVELTIEERNLLSVGYKNV 95 EMVDAMKK+AKLDVELT+EERNLLSVGYKNV Sbjct: 25 EMVDAMKKVAKLDVELTVEERNLLSVGYKNV 55 >XP_006370163.1 hypothetical protein POPTR_0001s40270g [Populus trichocarpa] ERP66732.1 hypothetical protein POPTR_0001s40270g [Populus trichocarpa] Length = 275 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 3 EMVDAMKKLAKLDVELTIEERNLLSVGYKNV 95 EMVDAMKK+AKLDVELT+EERNLLSVGYKNV Sbjct: 25 EMVDAMKKVAKLDVELTVEERNLLSVGYKNV 55 >XP_006370164.1 hypothetical protein POPTR_0001s40270g [Populus trichocarpa] ERP66733.1 hypothetical protein POPTR_0001s40270g [Populus trichocarpa] Length = 276 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 3 EMVDAMKKLAKLDVELTIEERNLLSVGYKNV 95 EMVDAMKK+AKLDVELT+EERNLLSVGYKNV Sbjct: 25 EMVDAMKKVAKLDVELTVEERNLLSVGYKNV 55 >KVI10474.1 14-3-3 domain-containing protein [Cynara cardunculus var. scolymus] Length = 257 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +3 Query: 3 EMVDAMKKLAKLDVELTIEERNLLSVGYKNV 95 EMVDAMKK+AKLD+ELT+EERNLLSVGYKNV Sbjct: 25 EMVDAMKKVAKLDIELTVEERNLLSVGYKNV 55 >NP_001296639.1 14-3-3-like protein C [Cicer arietinum] ABQ95991.1 14-3-3-like protein [Cicer arietinum] ABQ95993.1 14-3-3-like protein [Cicer arietinum] Length = 259 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +3 Query: 3 EMVDAMKKLAKLDVELTIEERNLLSVGYKNV 95 EMVDAMKK+AKLDVELT+EERNLLS+GYKNV Sbjct: 23 EMVDAMKKVAKLDVELTVEERNLLSIGYKNV 53 >XP_017256844.1 PREDICTED: 14-3-3-like protein C [Daucus carota subsp. sativus] Length = 260 Score = 60.1 bits (144), Expect = 2e-07 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 3 EMVDAMKKLAKLDVELTIEERNLLSVGYKNV 95 EMVDAMK LAKLDVELTIEERNLLSVGYKNV Sbjct: 25 EMVDAMKNLAKLDVELTIEERNLLSVGYKNV 55