BLASTX nr result
ID: Panax24_contig00019787
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00019787 (366 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009348818.1 PREDICTED: putative phosphatidylglycerol/phosphat... 59 1e-08 KDO70652.1 hypothetical protein CISIN_1g0317442mg, partial [Citr... 57 7e-08 XP_009362677.1 PREDICTED: putative phosphatidylglycerol/phosphat... 57 7e-08 XP_008391987.1 PREDICTED: putative phosphatidylglycerol/phosphat... 57 1e-07 KDP36091.1 hypothetical protein JCGZ_08735 [Jatropha curcas] 57 1e-07 XP_006481619.1 PREDICTED: putative phosphatidylglycerol/phosphat... 57 1e-07 XP_012074287.1 PREDICTED: putative phosphatidylglycerol/phosphat... 57 1e-07 XP_007202709.1 hypothetical protein PRUPE_ppa012768mg [Prunus pe... 57 1e-07 XP_009789276.1 PREDICTED: putative phosphatidylglycerol/phosphat... 56 2e-07 XP_008387120.1 PREDICTED: putative phosphatidylglycerol/phosphat... 56 3e-07 XP_006430042.1 hypothetical protein CICLE_v10013007mg [Citrus cl... 55 4e-07 XP_004249400.1 PREDICTED: putative phosphatidylglycerol/phosphat... 55 5e-07 XP_018851174.1 PREDICTED: putative phosphatidylglycerol/phosphat... 54 1e-06 XP_015055538.1 PREDICTED: putative phosphatidylglycerol/phosphat... 54 2e-06 XP_002524079.1 PREDICTED: putative phosphatidylglycerol/phosphat... 54 2e-06 XP_019239426.1 PREDICTED: putative phosphatidylglycerol/phosphat... 54 2e-06 XP_014512491.1 PREDICTED: putative phosphatidylglycerol/phosphat... 53 3e-06 XP_017413688.1 PREDICTED: putative phosphatidylglycerol/phosphat... 53 3e-06 GAV85736.1 E1_DerP2_DerF2 domain-containing protein [Cephalotus ... 53 3e-06 XP_017246857.1 PREDICTED: putative phosphatidylglycerol/phosphat... 53 3e-06 >XP_009348818.1 PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 [Pyrus x bretschneideri] Length = 155 Score = 59.3 bits (142), Expect = 1e-08 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -2 Query: 98 KDIKYCDKKADYDIKISGVEITPYPVKRGKSA 3 KD+ YCDKKADYD+K+S V+ITPYPV RGK A Sbjct: 27 KDVNYCDKKADYDVKVSAVDITPYPVARGKPA 58 >KDO70652.1 hypothetical protein CISIN_1g0317442mg, partial [Citrus sinensis] Length = 117 Score = 56.6 bits (135), Expect = 7e-08 Identities = 22/35 (62%), Positives = 29/35 (82%) Frame = -2 Query: 107 AKDKDIKYCDKKADYDIKISGVEITPYPVKRGKSA 3 A+ D+KYCDK ADYD+K+ GV+I+PYPV RG+ A Sbjct: 21 ARATDVKYCDKNADYDVKVHGVDISPYPVARGREA 55 >XP_009362677.1 PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 [Pyrus x bretschneideri] Length = 155 Score = 57.4 bits (137), Expect = 7e-08 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -2 Query: 98 KDIKYCDKKADYDIKISGVEITPYPVKRGKSA 3 KD+ YCDKKADYD+K+S V+I PYPV RGK A Sbjct: 27 KDVNYCDKKADYDVKVSAVDINPYPVARGKPA 58 >XP_008391987.1 PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 [Malus domestica] Length = 155 Score = 57.0 bits (136), Expect = 1e-07 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -2 Query: 98 KDIKYCDKKADYDIKISGVEITPYPVKRGKSA 3 KD+ YCDK ADYD+K+S V+ITPYPV RGK A Sbjct: 27 KDVNYCDKTADYDVKVSAVDITPYPVARGKPA 58 >KDP36091.1 hypothetical protein JCGZ_08735 [Jatropha curcas] Length = 153 Score = 56.6 bits (135), Expect = 1e-07 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -2 Query: 95 DIKYCDKKADYDIKISGVEITPYPVKRGKSA 3 D+KYCDKK DYD+K+ GVEITP PV RG+SA Sbjct: 26 DVKYCDKKGDYDVKVKGVEITPNPVARGQSA 56 >XP_006481619.1 PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 [Citrus sinensis] Length = 153 Score = 56.6 bits (135), Expect = 1e-07 Identities = 22/35 (62%), Positives = 29/35 (82%) Frame = -2 Query: 107 AKDKDIKYCDKKADYDIKISGVEITPYPVKRGKSA 3 A+ D+KYCDK ADYD+K+ GV+I+PYPV RG+ A Sbjct: 21 ARATDVKYCDKNADYDVKVRGVDISPYPVARGREA 55 >XP_012074287.1 PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 [Jatropha curcas] Length = 155 Score = 56.6 bits (135), Expect = 1e-07 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -2 Query: 95 DIKYCDKKADYDIKISGVEITPYPVKRGKSA 3 D+KYCDKK DYD+K+ GVEITP PV RG+SA Sbjct: 28 DVKYCDKKGDYDVKVKGVEITPNPVARGQSA 58 >XP_007202709.1 hypothetical protein PRUPE_ppa012768mg [Prunus persica] XP_008241082.1 PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 [Prunus mume] ONH95846.1 hypothetical protein PRUPE_7G092100 [Prunus persica] Length = 155 Score = 56.6 bits (135), Expect = 1e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -2 Query: 98 KDIKYCDKKADYDIKISGVEITPYPVKRGKSA 3 KD+ YCDKKADYD+K+ VEI PYPV RGK A Sbjct: 24 KDVNYCDKKADYDVKVKAVEIIPYPVARGKPA 55 >XP_009789276.1 PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 [Nicotiana sylvestris] Length = 163 Score = 56.2 bits (134), Expect = 2e-07 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = -2 Query: 107 AKDKDIKYCDKKADYDIKISGVEITPYPVKRGK 9 AK D +YC+KKA+Y +K+SGV+ITPYPVKRGK Sbjct: 28 AKSTDFQYCNKKANYAVKVSGVDITPYPVKRGK 60 >XP_008387120.1 PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 [Malus domestica] Length = 155 Score = 55.8 bits (133), Expect = 3e-07 Identities = 22/32 (68%), Positives = 26/32 (81%) Frame = -2 Query: 98 KDIKYCDKKADYDIKISGVEITPYPVKRGKSA 3 KD+ YCDKK DYD+K+S V+I PYPV RGK A Sbjct: 27 KDVNYCDKKVDYDVKVSAVDINPYPVARGKPA 58 >XP_006430042.1 hypothetical protein CICLE_v10013007mg [Citrus clementina] ESR43282.1 hypothetical protein CICLE_v10013007mg [Citrus clementina] Length = 153 Score = 55.5 bits (132), Expect = 4e-07 Identities = 21/31 (67%), Positives = 27/31 (87%) Frame = -2 Query: 95 DIKYCDKKADYDIKISGVEITPYPVKRGKSA 3 D+KYCDK ADYD+K+ GV+I+PYPV RG+ A Sbjct: 25 DVKYCDKNADYDVKVHGVDISPYPVARGREA 55 >XP_004249400.1 PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0278295 [Solanum lycopersicum] Length = 155 Score = 55.1 bits (131), Expect = 5e-07 Identities = 23/35 (65%), Positives = 28/35 (80%) Frame = -2 Query: 107 AKDKDIKYCDKKADYDIKISGVEITPYPVKRGKSA 3 AK D YC+KKADY +K++GV+ITPYPVK GK A Sbjct: 22 AKSTDFHYCNKKADYAVKVNGVDITPYPVKGGKEA 56 >XP_018851174.1 PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 [Juglans regia] Length = 154 Score = 54.3 bits (129), Expect = 1e-06 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = -2 Query: 95 DIKYCDKKADYDIKISGVEITPYPVKRGKSA 3 D+KYCDK ADY +K++GVEI PYPV RGK A Sbjct: 27 DVKYCDKNADYAVKVTGVEIIPYPVARGKPA 57 >XP_015055538.1 PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0278295 [Solanum pennellii] Length = 155 Score = 53.5 bits (127), Expect = 2e-06 Identities = 22/34 (64%), Positives = 27/34 (79%) Frame = -2 Query: 104 KDKDIKYCDKKADYDIKISGVEITPYPVKRGKSA 3 K D YC+KKADY +K++GV+ITPYPVK GK A Sbjct: 23 KSTDFHYCNKKADYAVKVNGVDITPYPVKGGKEA 56 >XP_002524079.1 PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 [Ricinus communis] EEF38289.1 Phosphatidylglycerol/phosphatidylinositol transfer protein precursor, putative [Ricinus communis] Length = 155 Score = 53.5 bits (127), Expect = 2e-06 Identities = 21/31 (67%), Positives = 27/31 (87%) Frame = -2 Query: 95 DIKYCDKKADYDIKISGVEITPYPVKRGKSA 3 D++YCDKKADYD+K+ GVEI+P PV RG+ A Sbjct: 28 DVRYCDKKADYDVKVKGVEISPNPVVRGQQA 58 >XP_019239426.1 PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 [Nicotiana attenuata] OIT21031.1 hypothetical protein A4A49_38492 [Nicotiana attenuata] Length = 156 Score = 53.5 bits (127), Expect = 2e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -2 Query: 107 AKDKDIKYCDKKADYDIKISGVEITPYPVKRGK 9 AK D +YC+KKA+Y +K+SGV+ITPYPVK GK Sbjct: 25 AKSTDFQYCNKKANYAVKVSGVDITPYPVKGGK 57 >XP_014512491.1 PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 [Vigna radiata var. radiata] Length = 152 Score = 53.1 bits (126), Expect = 3e-06 Identities = 21/31 (67%), Positives = 28/31 (90%) Frame = -2 Query: 95 DIKYCDKKADYDIKISGVEITPYPVKRGKSA 3 DI+YCDKKADYD+++SGVEI+P P+ RG+ A Sbjct: 25 DIRYCDKKADYDVEVSGVEISPDPIARGQPA 55 >XP_017413688.1 PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 [Vigna angularis] KOM34019.1 hypothetical protein LR48_Vigan02g016900 [Vigna angularis] BAT96531.1 hypothetical protein VIGAN_08348700 [Vigna angularis var. angularis] Length = 152 Score = 53.1 bits (126), Expect = 3e-06 Identities = 21/31 (67%), Positives = 28/31 (90%) Frame = -2 Query: 95 DIKYCDKKADYDIKISGVEITPYPVKRGKSA 3 DI+YCDKKADYD+++SGVEI+P P+ RG+ A Sbjct: 25 DIRYCDKKADYDVEVSGVEISPDPIARGQPA 55 >GAV85736.1 E1_DerP2_DerF2 domain-containing protein [Cephalotus follicularis] Length = 155 Score = 53.1 bits (126), Expect = 3e-06 Identities = 21/31 (67%), Positives = 27/31 (87%) Frame = -2 Query: 95 DIKYCDKKADYDIKISGVEITPYPVKRGKSA 3 DI YCDKK DY +K++GV+I+PYPV RGK+A Sbjct: 28 DIHYCDKKGDYAVKVTGVDISPYPVARGKAA 58 >XP_017246857.1 PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 [Daucus carota subsp. sativus] Length = 156 Score = 53.1 bits (126), Expect = 3e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 95 DIKYCDKKADYDIKISGVEITPYPVKRGKSA 3 D+ YCDK A YD+KISGVEI PYPVKRGKSA Sbjct: 28 DVNYCDK-AYYDVKISGVEIKPYPVKRGKSA 57