BLASTX nr result
ID: Panax24_contig00019786
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00019786 (354 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009348818.1 PREDICTED: putative phosphatidylglycerol/phosphat... 60 8e-09 KDO70652.1 hypothetical protein CISIN_1g0317442mg, partial [Citr... 57 4e-08 XP_009362677.1 PREDICTED: putative phosphatidylglycerol/phosphat... 58 4e-08 XP_008391987.1 PREDICTED: putative phosphatidylglycerol/phosphat... 57 6e-08 KDP36091.1 hypothetical protein JCGZ_08735 [Jatropha curcas] 57 8e-08 XP_006481619.1 PREDICTED: putative phosphatidylglycerol/phosphat... 57 8e-08 XP_012074287.1 PREDICTED: putative phosphatidylglycerol/phosphat... 57 9e-08 XP_007202709.1 hypothetical protein PRUPE_ppa012768mg [Prunus pe... 57 9e-08 XP_009789276.1 PREDICTED: putative phosphatidylglycerol/phosphat... 57 1e-07 XP_008387120.1 PREDICTED: putative phosphatidylglycerol/phosphat... 56 2e-07 XP_006430042.1 hypothetical protein CICLE_v10013007mg [Citrus cl... 56 2e-07 XP_004249400.1 PREDICTED: putative phosphatidylglycerol/phosphat... 55 3e-07 XP_018851174.1 PREDICTED: putative phosphatidylglycerol/phosphat... 55 6e-07 XP_015055538.1 PREDICTED: putative phosphatidylglycerol/phosphat... 54 1e-06 XP_002524079.1 PREDICTED: putative phosphatidylglycerol/phosphat... 54 1e-06 XP_019239426.1 PREDICTED: putative phosphatidylglycerol/phosphat... 54 1e-06 XP_014512491.1 PREDICTED: putative phosphatidylglycerol/phosphat... 54 2e-06 XP_017413688.1 PREDICTED: putative phosphatidylglycerol/phosphat... 54 2e-06 GAV85736.1 E1_DerP2_DerF2 domain-containing protein [Cephalotus ... 54 2e-06 XP_017246857.1 PREDICTED: putative phosphatidylglycerol/phosphat... 54 2e-06 >XP_009348818.1 PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 [Pyrus x bretschneideri] Length = 155 Score = 59.7 bits (143), Expect = 8e-09 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -2 Query: 98 KDIKYCDKKADYDVKISGVEITPYPVKRGKSA 3 KD+ YCDKKADYDVK+S V+ITPYPV RGK A Sbjct: 27 KDVNYCDKKADYDVKVSAVDITPYPVARGKPA 58 >KDO70652.1 hypothetical protein CISIN_1g0317442mg, partial [Citrus sinensis] Length = 117 Score = 57.0 bits (136), Expect = 4e-08 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = -2 Query: 107 AKDKDIKYCDKKADYDVKISGVEITPYPVKRGKSA 3 A+ D+KYCDK ADYDVK+ GV+I+PYPV RG+ A Sbjct: 21 ARATDVKYCDKNADYDVKVHGVDISPYPVARGREA 55 >XP_009362677.1 PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 [Pyrus x bretschneideri] Length = 155 Score = 57.8 bits (138), Expect = 4e-08 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -2 Query: 98 KDIKYCDKKADYDVKISGVEITPYPVKRGKSA 3 KD+ YCDKKADYDVK+S V+I PYPV RGK A Sbjct: 27 KDVNYCDKKADYDVKVSAVDINPYPVARGKPA 58 >XP_008391987.1 PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 [Malus domestica] Length = 155 Score = 57.4 bits (137), Expect = 6e-08 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -2 Query: 98 KDIKYCDKKADYDVKISGVEITPYPVKRGKSA 3 KD+ YCDK ADYDVK+S V+ITPYPV RGK A Sbjct: 27 KDVNYCDKTADYDVKVSAVDITPYPVARGKPA 58 >KDP36091.1 hypothetical protein JCGZ_08735 [Jatropha curcas] Length = 153 Score = 57.0 bits (136), Expect = 8e-08 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -2 Query: 95 DIKYCDKKADYDVKISGVEITPYPVKRGKSA 3 D+KYCDKK DYDVK+ GVEITP PV RG+SA Sbjct: 26 DVKYCDKKGDYDVKVKGVEITPNPVARGQSA 56 >XP_006481619.1 PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 [Citrus sinensis] Length = 153 Score = 57.0 bits (136), Expect = 8e-08 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = -2 Query: 107 AKDKDIKYCDKKADYDVKISGVEITPYPVKRGKSA 3 A+ D+KYCDK ADYDVK+ GV+I+PYPV RG+ A Sbjct: 21 ARATDVKYCDKNADYDVKVRGVDISPYPVARGREA 55 >XP_012074287.1 PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 [Jatropha curcas] Length = 155 Score = 57.0 bits (136), Expect = 9e-08 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -2 Query: 95 DIKYCDKKADYDVKISGVEITPYPVKRGKSA 3 D+KYCDKK DYDVK+ GVEITP PV RG+SA Sbjct: 28 DVKYCDKKGDYDVKVKGVEITPNPVARGQSA 58 >XP_007202709.1 hypothetical protein PRUPE_ppa012768mg [Prunus persica] XP_008241082.1 PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 [Prunus mume] ONH95846.1 hypothetical protein PRUPE_7G092100 [Prunus persica] Length = 155 Score = 57.0 bits (136), Expect = 9e-08 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -2 Query: 98 KDIKYCDKKADYDVKISGVEITPYPVKRGKSA 3 KD+ YCDKKADYDVK+ VEI PYPV RGK A Sbjct: 24 KDVNYCDKKADYDVKVKAVEIIPYPVARGKPA 55 >XP_009789276.1 PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 [Nicotiana sylvestris] Length = 163 Score = 56.6 bits (135), Expect = 1e-07 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -2 Query: 107 AKDKDIKYCDKKADYDVKISGVEITPYPVKRGK 9 AK D +YC+KKA+Y VK+SGV+ITPYPVKRGK Sbjct: 28 AKSTDFQYCNKKANYAVKVSGVDITPYPVKRGK 60 >XP_008387120.1 PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 [Malus domestica] Length = 155 Score = 56.2 bits (134), Expect = 2e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -2 Query: 98 KDIKYCDKKADYDVKISGVEITPYPVKRGKSA 3 KD+ YCDKK DYDVK+S V+I PYPV RGK A Sbjct: 27 KDVNYCDKKVDYDVKVSAVDINPYPVARGKPA 58 >XP_006430042.1 hypothetical protein CICLE_v10013007mg [Citrus clementina] ESR43282.1 hypothetical protein CICLE_v10013007mg [Citrus clementina] Length = 153 Score = 55.8 bits (133), Expect = 2e-07 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -2 Query: 95 DIKYCDKKADYDVKISGVEITPYPVKRGKSA 3 D+KYCDK ADYDVK+ GV+I+PYPV RG+ A Sbjct: 25 DVKYCDKNADYDVKVHGVDISPYPVARGREA 55 >XP_004249400.1 PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0278295 [Solanum lycopersicum] Length = 155 Score = 55.5 bits (132), Expect = 3e-07 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = -2 Query: 107 AKDKDIKYCDKKADYDVKISGVEITPYPVKRGKSA 3 AK D YC+KKADY VK++GV+ITPYPVK GK A Sbjct: 22 AKSTDFHYCNKKADYAVKVNGVDITPYPVKGGKEA 56 >XP_018851174.1 PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 [Juglans regia] Length = 154 Score = 54.7 bits (130), Expect = 6e-07 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = -2 Query: 95 DIKYCDKKADYDVKISGVEITPYPVKRGKSA 3 D+KYCDK ADY VK++GVEI PYPV RGK A Sbjct: 27 DVKYCDKNADYAVKVTGVEIIPYPVARGKPA 57 >XP_015055538.1 PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0278295 [Solanum pennellii] Length = 155 Score = 53.9 bits (128), Expect = 1e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = -2 Query: 104 KDKDIKYCDKKADYDVKISGVEITPYPVKRGKSA 3 K D YC+KKADY VK++GV+ITPYPVK GK A Sbjct: 23 KSTDFHYCNKKADYAVKVNGVDITPYPVKGGKEA 56 >XP_002524079.1 PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 [Ricinus communis] EEF38289.1 Phosphatidylglycerol/phosphatidylinositol transfer protein precursor, putative [Ricinus communis] Length = 155 Score = 53.9 bits (128), Expect = 1e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -2 Query: 95 DIKYCDKKADYDVKISGVEITPYPVKRGKSA 3 D++YCDKKADYDVK+ GVEI+P PV RG+ A Sbjct: 28 DVRYCDKKADYDVKVKGVEISPNPVVRGQQA 58 >XP_019239426.1 PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 [Nicotiana attenuata] OIT21031.1 hypothetical protein A4A49_38492 [Nicotiana attenuata] Length = 156 Score = 53.9 bits (128), Expect = 1e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -2 Query: 107 AKDKDIKYCDKKADYDVKISGVEITPYPVKRGK 9 AK D +YC+KKA+Y VK+SGV+ITPYPVK GK Sbjct: 25 AKSTDFQYCNKKANYAVKVSGVDITPYPVKGGK 57 >XP_014512491.1 PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 [Vigna radiata var. radiata] Length = 152 Score = 53.5 bits (127), Expect = 2e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -2 Query: 95 DIKYCDKKADYDVKISGVEITPYPVKRGKSA 3 DI+YCDKKADYDV++SGVEI+P P+ RG+ A Sbjct: 25 DIRYCDKKADYDVEVSGVEISPDPIARGQPA 55 >XP_017413688.1 PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 [Vigna angularis] KOM34019.1 hypothetical protein LR48_Vigan02g016900 [Vigna angularis] BAT96531.1 hypothetical protein VIGAN_08348700 [Vigna angularis var. angularis] Length = 152 Score = 53.5 bits (127), Expect = 2e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -2 Query: 95 DIKYCDKKADYDVKISGVEITPYPVKRGKSA 3 DI+YCDKKADYDV++SGVEI+P P+ RG+ A Sbjct: 25 DIRYCDKKADYDVEVSGVEISPDPIARGQPA 55 >GAV85736.1 E1_DerP2_DerF2 domain-containing protein [Cephalotus follicularis] Length = 155 Score = 53.5 bits (127), Expect = 2e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -2 Query: 95 DIKYCDKKADYDVKISGVEITPYPVKRGKSA 3 DI YCDKK DY VK++GV+I+PYPV RGK+A Sbjct: 28 DIHYCDKKGDYAVKVTGVDISPYPVARGKAA 58 >XP_017246857.1 PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 [Daucus carota subsp. sativus] Length = 156 Score = 53.5 bits (127), Expect = 2e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 95 DIKYCDKKADYDVKISGVEITPYPVKRGKSA 3 D+ YCDK A YDVKISGVEI PYPVKRGKSA Sbjct: 28 DVNYCDK-AYYDVKISGVEIKPYPVKRGKSA 57