BLASTX nr result
ID: Panax24_contig00019663
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00019663 (730 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU45165.1 hypothetical protein TSUD_245300 [Trifolium subterran... 69 5e-12 KHN40031.1 hypothetical protein glysoja_009408 [Glycine soja] 62 2e-09 XP_011628259.1 PREDICTED: uncharacterized protein LOC18447583 is... 65 2e-08 XP_006857739.1 PREDICTED: uncharacterized protein LOC18447583 is... 65 2e-08 OIW16528.1 hypothetical protein TanjilG_32199 [Lupinus angustifo... 58 5e-08 XP_010942576.1 PREDICTED: GBF-interacting protein 1-like isoform... 63 1e-07 XP_010942575.1 PREDICTED: GBF-interacting protein 1-like isoform... 63 1e-07 XP_010942574.1 PREDICTED: GBF-interacting protein 1-like isoform... 63 1e-07 XP_010942572.1 PREDICTED: GBF-interacting protein 1-like isoform... 63 1e-07 XP_010942571.1 PREDICTED: GBF-interacting protein 1-like isoform... 63 1e-07 XP_010942570.1 PREDICTED: GBF-interacting protein 1-like isoform... 63 1e-07 XP_010942569.1 PREDICTED: GBF-interacting protein 1-like isoform... 63 1e-07 XP_010245043.1 PREDICTED: GBF-interacting protein 1-like isoform... 62 1e-07 XP_010245042.1 PREDICTED: GBF-interacting protein 1-like isoform... 62 1e-07 XP_010245041.1 PREDICTED: GBF-interacting protein 1-like isoform... 62 1e-07 XP_010245040.1 PREDICTED: GBF-interacting protein 1-like isoform... 62 1e-07 XP_002445374.1 hypothetical protein SORBIDRAFT_07g013800 [Sorghu... 57 2e-07 XP_002532215.2 PREDICTED: uncharacterized protein LOC8289706 [Ri... 62 2e-07 XP_020102847.1 GBF-interacting protein 1-like isoform X1 [Ananas... 62 2e-07 XP_020102848.1 GBF-interacting protein 1-like isoform X2 [Ananas... 62 2e-07 >GAU45165.1 hypothetical protein TSUD_245300 [Trifolium subterraneum] Length = 71 Score = 69.3 bits (168), Expect = 5e-12 Identities = 34/51 (66%), Positives = 41/51 (80%), Gaps = 1/51 (1%) Frame = +2 Query: 2 NIKEIAGNHNDEEIYIMLKECNMNPNETT*KLLLHGLF-SISIYMLFVFYL 151 NIKEI GNH+DE+IY MLKEC+M+PNET KLLL G+ SIS++MLF L Sbjct: 20 NIKEITGNHSDEDIYAMLKECSMDPNETAQKLLLQGIITSISLFMLFQLIL 70 >KHN40031.1 hypothetical protein glysoja_009408 [Glycine soja] Length = 58 Score = 62.0 bits (149), Expect = 2e-09 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +2 Query: 2 NIKEIAGNHNDEEIYIMLKECNMNPNETT*KLLLHGLFS 118 NIKEI GNH++E+IY MLKEC+M+PNETT KLLL G+ S Sbjct: 20 NIKEITGNHSEEDIYAMLKECSMDPNETTQKLLLQGIRS 58 >XP_011628259.1 PREDICTED: uncharacterized protein LOC18447583 isoform X2 [Amborella trichopoda] Length = 908 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +2 Query: 2 NIKEIAGNHNDEEIYIMLKECNMNPNETT*KLLLHGLF 115 NIKEIAGNH+D+EIY MLKECNM+PNETT KLLL F Sbjct: 23 NIKEIAGNHHDDEIYAMLKECNMDPNETTQKLLLQDTF 60 >XP_006857739.1 PREDICTED: uncharacterized protein LOC18447583 isoform X1 [Amborella trichopoda] ERN19206.1 hypothetical protein AMTR_s00061p00187940 [Amborella trichopoda] Length = 909 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +2 Query: 2 NIKEIAGNHNDEEIYIMLKECNMNPNETT*KLLLHGLF 115 NIKEIAGNH+D+EIY MLKECNM+PNETT KLLL F Sbjct: 23 NIKEIAGNHHDDEIYAMLKECNMDPNETTQKLLLQDTF 60 >OIW16528.1 hypothetical protein TanjilG_32199 [Lupinus angustifolius] Length = 61 Score = 58.2 bits (139), Expect = 5e-08 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +2 Query: 2 NIKEIAGNHNDEEIYIMLKECNMNPNETT*KLLL 103 NIKEI GNH+DE+IY MLKEC+M+PNET KLLL Sbjct: 20 NIKEITGNHSDEDIYAMLKECSMDPNETAQKLLL 53 >XP_010942576.1 PREDICTED: GBF-interacting protein 1-like isoform X5 [Elaeis guineensis] Length = 891 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +2 Query: 2 NIKEIAGNHNDEEIYIMLKECNMNPNETT*KLLLHGLF 115 NIKEIAGNH+DEE+Y MLKEC+M+PNETT +LLL F Sbjct: 19 NIKEIAGNHSDEEVYAMLKECSMDPNETTQRLLLEDTF 56 >XP_010942575.1 PREDICTED: GBF-interacting protein 1-like isoform X4 [Elaeis guineensis] Length = 891 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +2 Query: 2 NIKEIAGNHNDEEIYIMLKECNMNPNETT*KLLLHGLF 115 NIKEIAGNH+DEE+Y MLKEC+M+PNETT +LLL F Sbjct: 19 NIKEIAGNHSDEEVYAMLKECSMDPNETTQRLLLEDTF 56 >XP_010942574.1 PREDICTED: GBF-interacting protein 1-like isoform X7 [Elaeis guineensis] Length = 891 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +2 Query: 2 NIKEIAGNHNDEEIYIMLKECNMNPNETT*KLLLHGLF 115 NIKEIAGNH+DEE+Y MLKEC+M+PNETT +LLL F Sbjct: 19 NIKEIAGNHSDEEVYAMLKECSMDPNETTQRLLLEDTF 56 >XP_010942572.1 PREDICTED: GBF-interacting protein 1-like isoform X3 [Elaeis guineensis] Length = 892 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +2 Query: 2 NIKEIAGNHNDEEIYIMLKECNMNPNETT*KLLLHGLF 115 NIKEIAGNH+DEE+Y MLKEC+M+PNETT +LLL F Sbjct: 19 NIKEIAGNHSDEEVYAMLKECSMDPNETTQRLLLEDTF 56 >XP_010942571.1 PREDICTED: GBF-interacting protein 1-like isoform X2 [Elaeis guineensis] Length = 892 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +2 Query: 2 NIKEIAGNHNDEEIYIMLKECNMNPNETT*KLLLHGLF 115 NIKEIAGNH+DEE+Y MLKEC+M+PNETT +LLL F Sbjct: 19 NIKEIAGNHSDEEVYAMLKECSMDPNETTQRLLLEDTF 56 >XP_010942570.1 PREDICTED: GBF-interacting protein 1-like isoform X1 [Elaeis guineensis] Length = 892 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +2 Query: 2 NIKEIAGNHNDEEIYIMLKECNMNPNETT*KLLLHGLF 115 NIKEIAGNH+DEE+Y MLKEC+M+PNETT +LLL F Sbjct: 19 NIKEIAGNHSDEEVYAMLKECSMDPNETTQRLLLEDTF 56 >XP_010942569.1 PREDICTED: GBF-interacting protein 1-like isoform X6 [Elaeis guineensis] Length = 893 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +2 Query: 2 NIKEIAGNHNDEEIYIMLKECNMNPNETT*KLLLHGLF 115 NIKEIAGNH+DEE+Y MLKEC+M+PNETT +LLL F Sbjct: 19 NIKEIAGNHSDEEVYAMLKECSMDPNETTQRLLLEDTF 56 >XP_010245043.1 PREDICTED: GBF-interacting protein 1-like isoform X4 [Nelumbo nucifera] Length = 897 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +2 Query: 2 NIKEIAGNHNDEEIYIMLKECNMNPNETT*KLLLHGLF 115 NIKEIAGNH+DEEIY MLKEC+M+PNET KLLL F Sbjct: 20 NIKEIAGNHSDEEIYAMLKECSMDPNETAQKLLLQDTF 57 >XP_010245042.1 PREDICTED: GBF-interacting protein 1-like isoform X3 [Nelumbo nucifera] Length = 914 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +2 Query: 2 NIKEIAGNHNDEEIYIMLKECNMNPNETT*KLLLHGLF 115 NIKEIAGNH+DEEIY MLKEC+M+PNET KLLL F Sbjct: 20 NIKEIAGNHSDEEIYAMLKECSMDPNETAQKLLLQDTF 57 >XP_010245041.1 PREDICTED: GBF-interacting protein 1-like isoform X2 [Nelumbo nucifera] Length = 922 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +2 Query: 2 NIKEIAGNHNDEEIYIMLKECNMNPNETT*KLLLHGLF 115 NIKEIAGNH+DEEIY MLKEC+M+PNET KLLL F Sbjct: 20 NIKEIAGNHSDEEIYAMLKECSMDPNETAQKLLLQDTF 57 >XP_010245040.1 PREDICTED: GBF-interacting protein 1-like isoform X1 [Nelumbo nucifera] Length = 952 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +2 Query: 2 NIKEIAGNHNDEEIYIMLKECNMNPNETT*KLLLHGLF 115 NIKEIAGNH+DEEIY MLKEC+M+PNET KLLL F Sbjct: 20 NIKEIAGNHSDEEIYAMLKECSMDPNETAQKLLLQDTF 57 >XP_002445374.1 hypothetical protein SORBIDRAFT_07g013800 [Sorghum bicolor] Length = 70 Score = 57.0 bits (136), Expect = 2e-07 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = +2 Query: 2 NIKEIAGNHNDEEIYIMLKECNMNPNETT*KLLLHGLF 115 +IKEIAG H DEE+Y ML+ECNM+PNET +LLL F Sbjct: 19 DIKEIAGGHTDEEVYAMLRECNMDPNETAQRLLLEDTF 56 >XP_002532215.2 PREDICTED: uncharacterized protein LOC8289706 [Ricinus communis] Length = 747 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/45 (60%), Positives = 37/45 (82%) Frame = +2 Query: 2 NIKEIAGNHNDEEIYIMLKECNMNPNETT*KLLLHGLFSISIYML 136 +IKEI GNH++EEIY ML++C+M+PNET KLLL G+F ++I L Sbjct: 20 DIKEITGNHSEEEIYAMLRDCSMDPNETAQKLLLQGMFIVNIQSL 64 >XP_020102847.1 GBF-interacting protein 1-like isoform X1 [Ananas comosus] Length = 752 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +2 Query: 2 NIKEIAGNHNDEEIYIMLKECNMNPNETT*KLLLHGLF 115 NIKEIAGNH+DEE+Y MLKEC+M+PNET KLLL F Sbjct: 20 NIKEIAGNHSDEEVYAMLKECSMDPNETAQKLLLQDTF 57 >XP_020102848.1 GBF-interacting protein 1-like isoform X2 [Ananas comosus] Length = 804 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +2 Query: 2 NIKEIAGNHNDEEIYIMLKECNMNPNETT*KLLLHGLF 115 NIKEIAGNH+DEE+Y MLKEC+M+PNET KLLL F Sbjct: 20 NIKEIAGNHSDEEVYAMLKECSMDPNETAQKLLLQDTF 57