BLASTX nr result
ID: Panax24_contig00019550
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00019550 (359 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007215856.1 hypothetical protein PRUPE_ppa010408mg [Prunus pe... 43 2e-07 XP_007215857.1 hypothetical protein PRUPE_ppa010408mg [Prunus pe... 43 2e-07 XP_008230441.1 PREDICTED: plant UBX domain-containing protein 1 ... 41 5e-07 XP_016649018.1 PREDICTED: plant UBX domain-containing protein 1-... 41 5e-07 XP_015901260.1 PREDICTED: plant UBX domain-containing protein 1-... 42 7e-07 KVI02489.1 UBX-like protein [Cynara cardunculus var. scolymus] 41 7e-07 XP_010425476.1 PREDICTED: plant UBX domain-containing protein 1 ... 41 1e-06 XP_010425477.1 PREDICTED: plant UBX domain-containing protein 1 ... 41 1e-06 XP_002266652.1 PREDICTED: plant UBX domain-containing protein 1 ... 41 1e-06 CBI40089.3 unnamed protein product, partial [Vitis vinifera] 41 1e-06 XP_015898471.1 PREDICTED: plant UBX domain-containing protein 1-... 42 2e-06 XP_008230920.2 PREDICTED: plant UBX domain-containing protein 1-... 41 2e-06 EEF35410.1 conserved hypothetical protein [Ricinus communis] 40 3e-06 XP_013595490.1 PREDICTED: plant UBX domain-containing protein 1 ... 41 3e-06 XP_009151974.1 PREDICTED: plant UBX domain-containing protein 1 ... 41 3e-06 CDX83678.1 BnaC07g24180D [Brassica napus] 41 3e-06 XP_013644658.1 PREDICTED: plant UBX domain-containing protein 1-... 41 3e-06 XP_013595492.1 PREDICTED: plant UBX domain-containing protein 1 ... 41 3e-06 XP_013644659.1 PREDICTED: plant UBX domain-containing protein 1-... 41 3e-06 XP_002877036.1 plant UBX domain-containing protein 1 [Arabidopsi... 41 3e-06 >XP_007215856.1 hypothetical protein PRUPE_ppa010408mg [Prunus persica] ONI19821.1 hypothetical protein PRUPE_3G299600 [Prunus persica] Length = 250 Score = 42.7 bits (99), Expect(2) = 2e-07 Identities = 21/33 (63%), Positives = 23/33 (69%), Gaps = 9/33 (27%) Frame = -1 Query: 74 IARPELPFYIYT---------TSQDLYSSGFAP 3 +ARPELPFYIYT TSQDLYS+GF P Sbjct: 140 VARPELPFYIYTTPPKKQIKDTSQDLYSAGFVP 172 Score = 39.7 bits (91), Expect(2) = 2e-07 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 124 KAVIRVRFPDNHTLEATLH 68 K VIRVRFPDNHTLEAT H Sbjct: 106 KTVIRVRFPDNHTLEATFH 124 >XP_007215857.1 hypothetical protein PRUPE_ppa010408mg [Prunus persica] ONI19822.1 hypothetical protein PRUPE_3G299600 [Prunus persica] Length = 249 Score = 42.7 bits (99), Expect(2) = 2e-07 Identities = 21/33 (63%), Positives = 23/33 (69%), Gaps = 9/33 (27%) Frame = -1 Query: 74 IARPELPFYIYT---------TSQDLYSSGFAP 3 +ARPELPFYIYT TSQDLYS+GF P Sbjct: 140 VARPELPFYIYTTPPKKQIKDTSQDLYSAGFVP 172 Score = 39.7 bits (91), Expect(2) = 2e-07 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 124 KAVIRVRFPDNHTLEATLH 68 K VIRVRFPDNHTLEAT H Sbjct: 106 KTVIRVRFPDNHTLEATFH 124 >XP_008230441.1 PREDICTED: plant UBX domain-containing protein 1 [Prunus mume] Length = 249 Score = 41.2 bits (95), Expect(2) = 5e-07 Identities = 20/33 (60%), Positives = 22/33 (66%), Gaps = 9/33 (27%) Frame = -1 Query: 74 IARPELPFYIYT---------TSQDLYSSGFAP 3 +ARPELPFYIYT TSQD YS+GF P Sbjct: 140 VARPELPFYIYTTPPKKQIKDTSQDFYSAGFVP 172 Score = 39.7 bits (91), Expect(2) = 5e-07 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 124 KAVIRVRFPDNHTLEATLH 68 K VIRVRFPDNHTLEAT H Sbjct: 106 KTVIRVRFPDNHTLEATFH 124 >XP_016649018.1 PREDICTED: plant UBX domain-containing protein 1-like [Prunus mume] Length = 230 Score = 41.2 bits (95), Expect(2) = 5e-07 Identities = 20/33 (60%), Positives = 22/33 (66%), Gaps = 9/33 (27%) Frame = -1 Query: 74 IARPELPFYIYT---------TSQDLYSSGFAP 3 +ARPELPFYIYT TSQD YS+GF P Sbjct: 121 VARPELPFYIYTTTPKKQIKDTSQDFYSAGFVP 153 Score = 39.7 bits (91), Expect(2) = 5e-07 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 124 KAVIRVRFPDNHTLEATLH 68 K VIRVRFPDNHTLEAT H Sbjct: 87 KTVIRVRFPDNHTLEATFH 105 >XP_015901260.1 PREDICTED: plant UBX domain-containing protein 1-like [Ziziphus jujuba] Length = 257 Score = 42.0 bits (97), Expect(2) = 7e-07 Identities = 19/37 (51%), Positives = 25/37 (67%), Gaps = 9/37 (24%) Frame = -1 Query: 86 IRSHIARPELPFYIYTT---------SQDLYSSGFAP 3 ++ +ARP+LPFY+YTT SQD YS+GFAP Sbjct: 141 LKKAVARPDLPFYVYTTPPKEKIKDMSQDFYSAGFAP 177 Score = 38.5 bits (88), Expect(2) = 7e-07 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 124 KAVIRVRFPDNHTLEATLH 68 +A IRVRFPDNHTLEAT H Sbjct: 111 RATIRVRFPDNHTLEATFH 129 >KVI02489.1 UBX-like protein [Cynara cardunculus var. scolymus] Length = 185 Score = 41.2 bits (95), Expect(2) = 7e-07 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 124 KAVIRVRFPDNHTLEATLH 68 KAVIRVRFPDNHTLEAT H Sbjct: 50 KAVIRVRFPDNHTLEATFH 68 Score = 39.3 bits (90), Expect(2) = 7e-07 Identities = 19/33 (57%), Positives = 22/33 (66%), Gaps = 9/33 (27%) Frame = -1 Query: 74 IARPELPFYIYTT---------SQDLYSSGFAP 3 +A+P LPFYIYTT SQD YS+GFAP Sbjct: 84 VAQPNLPFYIYTTPPKKQIKDMSQDFYSAGFAP 116 >XP_010425476.1 PREDICTED: plant UBX domain-containing protein 1 isoform X1 [Camelina sativa] Length = 254 Score = 41.2 bits (95), Expect(2) = 1e-06 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 124 KAVIRVRFPDNHTLEATLH 68 KAVIRVRFPDNHTLEAT H Sbjct: 111 KAVIRVRFPDNHTLEATFH 129 Score = 38.1 bits (87), Expect(2) = 1e-06 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 9/37 (24%) Frame = -1 Query: 86 IRSHIARPELPFYIYTT---------SQDLYSSGFAP 3 +R +A P++PFY+YTT SQD YS+GF P Sbjct: 141 VRRVVAHPDIPFYLYTTPPKKQIKDFSQDFYSAGFVP 177 >XP_010425477.1 PREDICTED: plant UBX domain-containing protein 1 isoform X2 [Camelina sativa] Length = 253 Score = 41.2 bits (95), Expect(2) = 1e-06 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 124 KAVIRVRFPDNHTLEATLH 68 KAVIRVRFPDNHTLEAT H Sbjct: 110 KAVIRVRFPDNHTLEATFH 128 Score = 38.1 bits (87), Expect(2) = 1e-06 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 9/37 (24%) Frame = -1 Query: 86 IRSHIARPELPFYIYTT---------SQDLYSSGFAP 3 +R +A P++PFY+YTT SQD YS+GF P Sbjct: 140 VRRVVAHPDIPFYLYTTPPKKQIKDFSQDFYSAGFVP 176 >XP_002266652.1 PREDICTED: plant UBX domain-containing protein 1 isoform X2 [Vitis vinifera] Length = 250 Score = 41.2 bits (95), Expect(2) = 1e-06 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 124 KAVIRVRFPDNHTLEATLH 68 KAVIRVRFPDNHTLEAT H Sbjct: 104 KAVIRVRFPDNHTLEATFH 122 Score = 38.1 bits (87), Expect(2) = 1e-06 Identities = 19/33 (57%), Positives = 21/33 (63%), Gaps = 9/33 (27%) Frame = -1 Query: 74 IARPELPFYIYTT---------SQDLYSSGFAP 3 IA+PELPFYIYT SQD YS+GF P Sbjct: 138 IAQPELPFYIYTAPPKKQIKDMSQDFYSAGFVP 170 >CBI40089.3 unnamed protein product, partial [Vitis vinifera] Length = 231 Score = 41.2 bits (95), Expect(2) = 1e-06 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 124 KAVIRVRFPDNHTLEATLH 68 KAVIRVRFPDNHTLEAT H Sbjct: 85 KAVIRVRFPDNHTLEATFH 103 Score = 38.1 bits (87), Expect(2) = 1e-06 Identities = 19/33 (57%), Positives = 21/33 (63%), Gaps = 9/33 (27%) Frame = -1 Query: 74 IARPELPFYIYTT---------SQDLYSSGFAP 3 IA+PELPFYIYT SQD YS+GF P Sbjct: 119 IAQPELPFYIYTAPPKKQIKDMSQDFYSAGFVP 151 >XP_015898471.1 PREDICTED: plant UBX domain-containing protein 1-like [Ziziphus jujuba] Length = 257 Score = 42.0 bits (97), Expect(2) = 2e-06 Identities = 20/37 (54%), Positives = 25/37 (67%), Gaps = 9/37 (24%) Frame = -1 Query: 86 IRSHIARPELPFYIYTT---------SQDLYSSGFAP 3 ++ IARP+LPFY+YTT SQD YS+GFAP Sbjct: 141 LKKVIARPDLPFYVYTTPPKEKIKDMSQDFYSAGFAP 177 Score = 37.0 bits (84), Expect(2) = 2e-06 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 124 KAVIRVRFPDNHTLEATLH 68 +A IRVRFPDNHTLE T H Sbjct: 111 RATIRVRFPDNHTLETTFH 129 >XP_008230920.2 PREDICTED: plant UBX domain-containing protein 1-like [Prunus mume] Length = 152 Score = 41.2 bits (95), Expect(2) = 2e-06 Identities = 20/33 (60%), Positives = 22/33 (66%), Gaps = 9/33 (27%) Frame = -1 Query: 74 IARPELPFYIYT---------TSQDLYSSGFAP 3 +ARPELPFYIYT TSQD YS+GF P Sbjct: 43 VARPELPFYIYTTTPKKQIKDTSQDFYSAGFVP 75 Score = 37.7 bits (86), Expect(2) = 2e-06 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 118 VIRVRFPDNHTLEATLH 68 VIRVRFPDNHTLEAT H Sbjct: 11 VIRVRFPDNHTLEATFH 27 >EEF35410.1 conserved hypothetical protein [Ricinus communis] Length = 304 Score = 40.4 bits (93), Expect(2) = 3e-06 Identities = 20/33 (60%), Positives = 22/33 (66%), Gaps = 9/33 (27%) Frame = -1 Query: 74 IARPELPFYIYTT---------SQDLYSSGFAP 3 IARPE+PFYIYTT SQD YS+GF P Sbjct: 193 IARPEVPFYIYTTPPKKQIKDLSQDFYSAGFVP 225 Score = 37.7 bits (86), Expect(2) = 3e-06 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 124 KAVIRVRFPDNHTLEATLH 68 KAVIRVRFPDNHTLE H Sbjct: 159 KAVIRVRFPDNHTLEVAFH 177 >XP_013595490.1 PREDICTED: plant UBX domain-containing protein 1 isoform X1 [Brassica oleracea var. oleracea] Length = 257 Score = 41.2 bits (95), Expect(2) = 3e-06 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 124 KAVIRVRFPDNHTLEATLH 68 KAVIRVRFPDNHTLEAT H Sbjct: 114 KAVIRVRFPDNHTLEATFH 132 Score = 37.0 bits (84), Expect(2) = 3e-06 Identities = 16/37 (43%), Positives = 24/37 (64%), Gaps = 9/37 (24%) Frame = -1 Query: 86 IRSHIARPELPFYIYTT---------SQDLYSSGFAP 3 ++ +A+P++PFY+YTT SQD YS+GF P Sbjct: 144 VKRALAQPDIPFYLYTTPPKKQLKDFSQDFYSAGFIP 180 >XP_009151974.1 PREDICTED: plant UBX domain-containing protein 1 isoform X1 [Brassica rapa] XP_013644656.1 PREDICTED: plant UBX domain-containing protein 1-like isoform X1 [Brassica napus] XP_013644660.1 PREDICTED: plant UBX domain-containing protein 1 isoform X1 [Brassica napus] Length = 257 Score = 41.2 bits (95), Expect(2) = 3e-06 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 124 KAVIRVRFPDNHTLEATLH 68 KAVIRVRFPDNHTLEAT H Sbjct: 114 KAVIRVRFPDNHTLEATFH 132 Score = 37.0 bits (84), Expect(2) = 3e-06 Identities = 16/37 (43%), Positives = 24/37 (64%), Gaps = 9/37 (24%) Frame = -1 Query: 86 IRSHIARPELPFYIYTT---------SQDLYSSGFAP 3 ++ +A+P++PFY+YTT SQD YS+GF P Sbjct: 144 VKRALAQPDIPFYLYTTPPKKQLKDFSQDFYSAGFIP 180 >CDX83678.1 BnaC07g24180D [Brassica napus] Length = 257 Score = 41.2 bits (95), Expect(2) = 3e-06 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 124 KAVIRVRFPDNHTLEATLH 68 KAVIRVRFPDNHTLEAT H Sbjct: 114 KAVIRVRFPDNHTLEATFH 132 Score = 37.0 bits (84), Expect(2) = 3e-06 Identities = 16/37 (43%), Positives = 24/37 (64%), Gaps = 9/37 (24%) Frame = -1 Query: 86 IRSHIARPELPFYIYTT---------SQDLYSSGFAP 3 ++ +A+P++PFY+YTT SQD YS+GF P Sbjct: 144 VKRALAQPDIPFYLYTTPPKKQLKDFSQDFYSAGFIP 180 >XP_013644658.1 PREDICTED: plant UBX domain-containing protein 1-like isoform X2 [Brassica napus] XP_013644661.1 PREDICTED: plant UBX domain-containing protein 1 isoform X2 [Brassica napus] Length = 256 Score = 41.2 bits (95), Expect(2) = 3e-06 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 124 KAVIRVRFPDNHTLEATLH 68 KAVIRVRFPDNHTLEAT H Sbjct: 113 KAVIRVRFPDNHTLEATFH 131 Score = 37.0 bits (84), Expect(2) = 3e-06 Identities = 16/37 (43%), Positives = 24/37 (64%), Gaps = 9/37 (24%) Frame = -1 Query: 86 IRSHIARPELPFYIYTT---------SQDLYSSGFAP 3 ++ +A+P++PFY+YTT SQD YS+GF P Sbjct: 143 VKRALAQPDIPFYLYTTPPKKQLKDFSQDFYSAGFIP 179 >XP_013595492.1 PREDICTED: plant UBX domain-containing protein 1 isoform X2 [Brassica oleracea var. oleracea] Length = 256 Score = 41.2 bits (95), Expect(2) = 3e-06 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 124 KAVIRVRFPDNHTLEATLH 68 KAVIRVRFPDNHTLEAT H Sbjct: 113 KAVIRVRFPDNHTLEATFH 131 Score = 37.0 bits (84), Expect(2) = 3e-06 Identities = 16/37 (43%), Positives = 24/37 (64%), Gaps = 9/37 (24%) Frame = -1 Query: 86 IRSHIARPELPFYIYTT---------SQDLYSSGFAP 3 ++ +A+P++PFY+YTT SQD YS+GF P Sbjct: 143 VKRALAQPDIPFYLYTTPPKKQLKDFSQDFYSAGFIP 179 >XP_013644659.1 PREDICTED: plant UBX domain-containing protein 1-like isoform X3 [Brassica napus] XP_013644662.1 PREDICTED: plant UBX domain-containing protein 1 isoform X3 [Brassica napus] XP_018514939.1 PREDICTED: plant UBX domain-containing protein 1 isoform X2 [Brassica rapa] Length = 255 Score = 41.2 bits (95), Expect(2) = 3e-06 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 124 KAVIRVRFPDNHTLEATLH 68 KAVIRVRFPDNHTLEAT H Sbjct: 112 KAVIRVRFPDNHTLEATFH 130 Score = 37.0 bits (84), Expect(2) = 3e-06 Identities = 16/37 (43%), Positives = 24/37 (64%), Gaps = 9/37 (24%) Frame = -1 Query: 86 IRSHIARPELPFYIYTT---------SQDLYSSGFAP 3 ++ +A+P++PFY+YTT SQD YS+GF P Sbjct: 142 VKRALAQPDIPFYLYTTPPKKQLKDFSQDFYSAGFIP 178 >XP_002877036.1 plant UBX domain-containing protein 1 [Arabidopsis lyrata subsp. lyrata] EFH53295.1 plant UBX domain-containing protein 1 [Arabidopsis lyrata subsp. lyrata] Length = 251 Score = 41.2 bits (95), Expect(2) = 3e-06 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 124 KAVIRVRFPDNHTLEATLH 68 KAVIRVRFPDNHTLEAT H Sbjct: 108 KAVIRVRFPDNHTLEATFH 126 Score = 37.0 bits (84), Expect(2) = 3e-06 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 9/37 (24%) Frame = -1 Query: 86 IRSHIARPELPFYIYTT---------SQDLYSSGFAP 3 ++ +A P++PFY+YTT SQD YS+GF P Sbjct: 138 VKRVVAHPDIPFYLYTTPPKKQIKDFSQDFYSAGFVP 174