BLASTX nr result
ID: Panax24_contig00019545
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00019545 (436 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN39679.1 hypothetical protein glysoja_020757 [Glycine soja] 53 5e-06 >KHN39679.1 hypothetical protein glysoja_020757 [Glycine soja] Length = 134 Score = 52.8 bits (125), Expect = 5e-06 Identities = 29/49 (59%), Positives = 34/49 (69%) Frame = +2 Query: 224 SSGEIDVTNNGRATP*KLAIKVGEPKVYKYPTSKSHTIDVGHKSHTLQL 370 S+ + + N GRATP KLA+ VGEP V PT KSHT + G KSHTLQL Sbjct: 45 STSTVVIVNLGRATPQKLAVVVGEPLV--NPTLKSHTSNAGLKSHTLQL 91