BLASTX nr result
ID: Panax24_contig00019428
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00019428 (428 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM85029.1 hypothetical protein DCAR_027549 [Daucus carota subsp... 87 3e-18 XP_017223298.1 PREDICTED: glycosyltransferase family 64 protein ... 87 2e-17 XP_017243475.1 PREDICTED: glycosyltransferase family 64 protein ... 83 4e-16 OAY46223.1 hypothetical protein MANES_07G126700 [Manihot esculenta] 82 1e-15 XP_002526868.1 PREDICTED: glycosyltransferase family 64 protein ... 81 1e-15 XP_012087784.1 PREDICTED: glycosyltransferase family 64 protein ... 81 2e-15 XP_013605227.1 PREDICTED: glycosyltransferase family 64 protein ... 80 3e-15 XP_013663479.1 PREDICTED: glycosyltransferase family 64 protein ... 80 3e-15 XP_013663478.1 PREDICTED: glycosyltransferase family 64 protein ... 80 3e-15 GAV56776.1 Glyco_transf_64 domain-containing protein [Cephalotus... 80 4e-15 OAY38465.1 hypothetical protein MANES_10G016400 [Manihot esculenta] 80 4e-15 XP_002267908.1 PREDICTED: glycosyltransferase family 64 protein ... 80 4e-15 CBI25511.3 unnamed protein product, partial [Vitis vinifera] 80 5e-15 ONI24565.1 hypothetical protein PRUPE_2G247400 [Prunus persica] 80 6e-15 XP_008233729.1 PREDICTED: glycosyltransferase family 64 protein ... 80 6e-15 XP_007218330.1 hypothetical protein PRUPE_ppa008488mg [Prunus pe... 80 6e-15 XP_010427385.1 PREDICTED: glycosyltransferase family 64 protein ... 80 6e-15 XP_010516173.1 PREDICTED: glycosyltransferase family 64 protein ... 80 6e-15 XP_010504454.1 PREDICTED: glycosyltransferase family 64 protein ... 80 6e-15 XP_006291460.1 hypothetical protein CARUB_v10017597mg [Capsella ... 80 6e-15 >KZM85029.1 hypothetical protein DCAR_027549 [Daucus carota subsp. sativus] Length = 227 Score = 86.7 bits (213), Expect = 3e-18 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +2 Query: 2 WSVWWMGRYSMVLSKAAFFHKKYLSLYTNEMPASIREYT 118 WSVWWMGRYSMVLSKAAFFHKKYLSLYTNEMP+SIREYT Sbjct: 109 WSVWWMGRYSMVLSKAAFFHKKYLSLYTNEMPSSIREYT 147 >XP_017223298.1 PREDICTED: glycosyltransferase family 64 protein C4-like [Daucus carota subsp. sativus] Length = 331 Score = 86.7 bits (213), Expect = 2e-17 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +2 Query: 2 WSVWWMGRYSMVLSKAAFFHKKYLSLYTNEMPASIREYT 118 WSVWWMGRYSMVLSKAAFFHKKYLSLYTNEMP+SIREYT Sbjct: 213 WSVWWMGRYSMVLSKAAFFHKKYLSLYTNEMPSSIREYT 251 >XP_017243475.1 PREDICTED: glycosyltransferase family 64 protein C4-like [Daucus carota subsp. sativus] KZN03039.1 hypothetical protein DCAR_011795 [Daucus carota subsp. sativus] Length = 331 Score = 82.8 bits (203), Expect = 4e-16 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +2 Query: 2 WSVWWMGRYSMVLSKAAFFHKKYLSLYTNEMPASIREYT 118 WSVWW GRYSMVLSKAAFFHKKYLS+YTN MPASIREYT Sbjct: 213 WSVWWTGRYSMVLSKAAFFHKKYLSMYTNNMPASIREYT 251 >OAY46223.1 hypothetical protein MANES_07G126700 [Manihot esculenta] Length = 330 Score = 81.6 bits (200), Expect = 1e-15 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +2 Query: 2 WSVWWMGRYSMVLSKAAFFHKKYLSLYTNEMPASIREYT 118 WSVWW G YSMVLSKAAFFHKKYLSLY+NEMPASIREYT Sbjct: 212 WSVWWTGTYSMVLSKAAFFHKKYLSLYSNEMPASIREYT 250 >XP_002526868.1 PREDICTED: glycosyltransferase family 64 protein C4 [Ricinus communis] EEF35499.1 Exostosin-2, putative [Ricinus communis] Length = 329 Score = 81.3 bits (199), Expect = 1e-15 Identities = 36/39 (92%), Positives = 36/39 (92%) Frame = +2 Query: 2 WSVWWMGRYSMVLSKAAFFHKKYLSLYTNEMPASIREYT 118 WSVWW G YSMVLSKAAFFHKKYL LYTNEMPASIREYT Sbjct: 211 WSVWWTGTYSMVLSKAAFFHKKYLRLYTNEMPASIREYT 249 >XP_012087784.1 PREDICTED: glycosyltransferase family 64 protein C4 [Jatropha curcas] KDP44815.1 hypothetical protein JCGZ_01315 [Jatropha curcas] Length = 330 Score = 81.3 bits (199), Expect = 2e-15 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = +2 Query: 2 WSVWWMGRYSMVLSKAAFFHKKYLSLYTNEMPASIREYT 118 WSVWW G YSM+LSKAAFFHKKYLSLYTNEMP SIREYT Sbjct: 212 WSVWWTGTYSMILSKAAFFHKKYLSLYTNEMPTSIREYT 250 >XP_013605227.1 PREDICTED: glycosyltransferase family 64 protein C4 [Brassica oleracea var. oleracea] XP_013655926.1 PREDICTED: glycosyltransferase family 64 protein C4 [Brassica napus] CDX72198.1 BnaC08g26760D [Brassica napus] Length = 330 Score = 80.5 bits (197), Expect = 3e-15 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +2 Query: 2 WSVWWMGRYSMVLSKAAFFHKKYLSLYTNEMPASIREYT 118 WSVWW G YSMVLSKAAFFHKKYLSLYTN+MPASIRE+T Sbjct: 212 WSVWWSGTYSMVLSKAAFFHKKYLSLYTNDMPASIREFT 250 >XP_013663479.1 PREDICTED: glycosyltransferase family 64 protein C4-like isoform X2 [Brassica napus] XP_013663482.1 PREDICTED: glycosyltransferase family 64 protein C4-like isoform X2 [Brassica napus] XP_013711998.1 PREDICTED: glycosyltransferase family 64 protein C4-like isoform X2 [Brassica napus] CDY27262.1 BnaA09g35400D [Brassica napus] Length = 330 Score = 80.5 bits (197), Expect = 3e-15 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +2 Query: 2 WSVWWMGRYSMVLSKAAFFHKKYLSLYTNEMPASIREYT 118 WSVWW G YSMVLSKAAFFHKKYLSLYTN+MPASIRE+T Sbjct: 212 WSVWWSGTYSMVLSKAAFFHKKYLSLYTNDMPASIREFT 250 >XP_013663478.1 PREDICTED: glycosyltransferase family 64 protein C4-like isoform X1 [Brassica napus] XP_013663481.1 PREDICTED: glycosyltransferase family 64 protein C4-like isoform X1 [Brassica napus] XP_013711997.1 PREDICTED: glycosyltransferase family 64 protein C4-like isoform X1 [Brassica napus] Length = 333 Score = 80.5 bits (197), Expect = 3e-15 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +2 Query: 2 WSVWWMGRYSMVLSKAAFFHKKYLSLYTNEMPASIREYT 118 WSVWW G YSMVLSKAAFFHKKYLSLYTN+MPASIRE+T Sbjct: 215 WSVWWSGTYSMVLSKAAFFHKKYLSLYTNDMPASIREFT 253 >GAV56776.1 Glyco_transf_64 domain-containing protein [Cephalotus follicularis] Length = 330 Score = 80.1 bits (196), Expect = 4e-15 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +2 Query: 2 WSVWWMGRYSMVLSKAAFFHKKYLSLYTNEMPASIREY 115 WSVWW G YSMVLSKAAFFHKKYLSLYTNEMPASI+EY Sbjct: 212 WSVWWTGTYSMVLSKAAFFHKKYLSLYTNEMPASIKEY 249 >OAY38465.1 hypothetical protein MANES_10G016400 [Manihot esculenta] Length = 330 Score = 80.1 bits (196), Expect = 4e-15 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +2 Query: 2 WSVWWMGRYSMVLSKAAFFHKKYLSLYTNEMPASIREY 115 WSVWW G YSMVLSKAAFFHKKYL+LYTNEMPASIREY Sbjct: 212 WSVWWTGTYSMVLSKAAFFHKKYLTLYTNEMPASIREY 249 >XP_002267908.1 PREDICTED: glycosyltransferase family 64 protein C4 [Vitis vinifera] Length = 338 Score = 80.1 bits (196), Expect = 4e-15 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = +2 Query: 2 WSVWWMGRYSMVLSKAAFFHKKYLSLYTNEMPASIREYT 118 WSVWW G YSMVLSKAAFFHKKY SLYTNEMPASIRE+T Sbjct: 220 WSVWWTGTYSMVLSKAAFFHKKYFSLYTNEMPASIREFT 258 >CBI25511.3 unnamed protein product, partial [Vitis vinifera] Length = 351 Score = 80.1 bits (196), Expect = 5e-15 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = +2 Query: 2 WSVWWMGRYSMVLSKAAFFHKKYLSLYTNEMPASIREYT 118 WSVWW G YSMVLSKAAFFHKKY SLYTNEMPASIRE+T Sbjct: 233 WSVWWTGTYSMVLSKAAFFHKKYFSLYTNEMPASIREFT 271 >ONI24565.1 hypothetical protein PRUPE_2G247400 [Prunus persica] Length = 329 Score = 79.7 bits (195), Expect = 6e-15 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +2 Query: 2 WSVWWMGRYSMVLSKAAFFHKKYLSLYTNEMPASIREY 115 WSVWW G YSMVLSKAAFFHKKYLSLYTNEMPASIRE+ Sbjct: 211 WSVWWTGTYSMVLSKAAFFHKKYLSLYTNEMPASIREF 248 >XP_008233729.1 PREDICTED: glycosyltransferase family 64 protein C4 [Prunus mume] Length = 329 Score = 79.7 bits (195), Expect = 6e-15 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +2 Query: 2 WSVWWMGRYSMVLSKAAFFHKKYLSLYTNEMPASIREY 115 WSVWW G YSMVLSKAAFFHKKYLSLYTNEMPASIRE+ Sbjct: 211 WSVWWTGSYSMVLSKAAFFHKKYLSLYTNEMPASIREF 248 >XP_007218330.1 hypothetical protein PRUPE_ppa008488mg [Prunus persica] ONI24566.1 hypothetical protein PRUPE_2G247400 [Prunus persica] Length = 329 Score = 79.7 bits (195), Expect = 6e-15 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +2 Query: 2 WSVWWMGRYSMVLSKAAFFHKKYLSLYTNEMPASIREY 115 WSVWW G YSMVLSKAAFFHKKYLSLYTNEMPASIRE+ Sbjct: 211 WSVWWTGTYSMVLSKAAFFHKKYLSLYTNEMPASIREF 248 >XP_010427385.1 PREDICTED: glycosyltransferase family 64 protein C4 [Camelina sativa] Length = 334 Score = 79.7 bits (195), Expect = 6e-15 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = +2 Query: 2 WSVWWMGRYSMVLSKAAFFHKKYLSLYTNEMPASIREYT 118 WSVWW G YSMVLSKAAFFHKKYLSLYTN MPASIRE+T Sbjct: 216 WSVWWSGTYSMVLSKAAFFHKKYLSLYTNSMPASIREFT 254 >XP_010516173.1 PREDICTED: glycosyltransferase family 64 protein C4 [Camelina sativa] Length = 334 Score = 79.7 bits (195), Expect = 6e-15 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = +2 Query: 2 WSVWWMGRYSMVLSKAAFFHKKYLSLYTNEMPASIREYT 118 WSVWW G YSMVLSKAAFFHKKYLSLYTN MPASIRE+T Sbjct: 216 WSVWWSGTYSMVLSKAAFFHKKYLSLYTNSMPASIREFT 254 >XP_010504454.1 PREDICTED: glycosyltransferase family 64 protein C4 [Camelina sativa] Length = 334 Score = 79.7 bits (195), Expect = 6e-15 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = +2 Query: 2 WSVWWMGRYSMVLSKAAFFHKKYLSLYTNEMPASIREYT 118 WSVWW G YSMVLSKAAFFHKKYLSLYTN MPASIRE+T Sbjct: 216 WSVWWSGTYSMVLSKAAFFHKKYLSLYTNSMPASIREFT 254 >XP_006291460.1 hypothetical protein CARUB_v10017597mg [Capsella rubella] EOA24358.1 hypothetical protein CARUB_v10017597mg [Capsella rubella] Length = 334 Score = 79.7 bits (195), Expect = 6e-15 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = +2 Query: 2 WSVWWMGRYSMVLSKAAFFHKKYLSLYTNEMPASIREYT 118 WSVWW G YSMVLSKAAFFHKKYLSLYTN MPASIRE+T Sbjct: 216 WSVWWSGTYSMVLSKAAFFHKKYLSLYTNNMPASIREFT 254