BLASTX nr result
ID: Panax24_contig00019352
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00019352 (461 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017181346.1 PREDICTED: protein VTE6, chloroplastic-like [Malu... 54 9e-07 XP_006370073.1 hypothetical protein POPTR_0001s39290g [Populus t... 55 4e-06 KDO49307.1 hypothetical protein CISIN_1g020374mg [Citrus sinensis] 55 5e-06 XP_006477828.1 PREDICTED: uncharacterized membrane protein sll08... 55 5e-06 XP_006442355.1 hypothetical protein CICLE_v10021126mg [Citrus cl... 55 5e-06 CDP06050.1 unnamed protein product [Coffea canephora] 55 6e-06 XP_010273464.1 PREDICTED: protein VTE6, chloroplastic isoform X2... 53 1e-05 >XP_017181346.1 PREDICTED: protein VTE6, chloroplastic-like [Malus domestica] Length = 88 Score = 53.9 bits (128), Expect = 9e-07 Identities = 25/28 (89%), Positives = 28/28 (100%) Frame = -1 Query: 461 WLNNDAVNVINISMGSILAVLMQRIVLQ 378 WLNNDAVNVINISMGSILAVLMQ+++LQ Sbjct: 60 WLNNDAVNVINISMGSILAVLMQQVLLQ 87 >XP_006370073.1 hypothetical protein POPTR_0001s39290g [Populus trichocarpa] ERP66642.1 hypothetical protein POPTR_0001s39290g [Populus trichocarpa] Length = 320 Score = 55.5 bits (132), Expect = 4e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 461 WLNNDAVNVINISMGSILAVLMQRIVLQK 375 WLNNDAVNVINISMGSILAVLMQ ++LQK Sbjct: 289 WLNNDAVNVINISMGSILAVLMQLVILQK 317 >KDO49307.1 hypothetical protein CISIN_1g020374mg [Citrus sinensis] Length = 327 Score = 55.1 bits (131), Expect = 5e-06 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -1 Query: 461 WLNNDAVNVINISMGSILAVLMQRIVLQ 378 WLNNDAVN+INISMGSILAVLMQ+IVLQ Sbjct: 296 WLNNDAVNIINISMGSILAVLMQQIVLQ 323 >XP_006477828.1 PREDICTED: uncharacterized membrane protein sll0875 [Citrus sinensis] Length = 327 Score = 55.1 bits (131), Expect = 5e-06 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -1 Query: 461 WLNNDAVNVINISMGSILAVLMQRIVLQ 378 WLNNDAVN+INISMGSILAVLMQ+IVLQ Sbjct: 296 WLNNDAVNIINISMGSILAVLMQQIVLQ 323 >XP_006442355.1 hypothetical protein CICLE_v10021126mg [Citrus clementina] ESR55595.1 hypothetical protein CICLE_v10021126mg [Citrus clementina] Length = 327 Score = 55.1 bits (131), Expect = 5e-06 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -1 Query: 461 WLNNDAVNVINISMGSILAVLMQRIVLQ 378 WLNNDAVN+INISMGSILAVLMQ+IVLQ Sbjct: 296 WLNNDAVNIINISMGSILAVLMQQIVLQ 323 >CDP06050.1 unnamed protein product [Coffea canephora] Length = 273 Score = 54.7 bits (130), Expect = 6e-06 Identities = 24/29 (82%), Positives = 29/29 (100%) Frame = -1 Query: 461 WLNNDAVNVINISMGSILAVLMQRIVLQK 375 WLNNDAVN+INIS+GSILAVLMQ+++LQK Sbjct: 245 WLNNDAVNIINISLGSILAVLMQQLILQK 273 >XP_010273464.1 PREDICTED: protein VTE6, chloroplastic isoform X2 [Nelumbo nucifera] Length = 184 Score = 53.1 bits (126), Expect = 1e-05 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 461 WLNNDAVNVINISMGSILAVLMQRIVLQK*Y 369 WLNND VNVINIS+GSI AVLMQ++VLQK Y Sbjct: 153 WLNNDVVNVINISLGSISAVLMQQVVLQKWY 183