BLASTX nr result
ID: Panax24_contig00019312
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00019312 (649 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO79114.1 hypothetical protein CISIN_1g0206321mg, partial [Citr... 55 7e-06 >KDO79114.1 hypothetical protein CISIN_1g0206321mg, partial [Citrus sinensis] Length = 194 Score = 55.1 bits (131), Expect = 7e-06 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +1 Query: 355 EAEISVIFY*CPGYLKLKMQSAYGARVAFVDFQIVCCC 468 E E++ +F CPG+LKLK+QS YG VAFVDFQ+ C C Sbjct: 116 EQELTQVFSKCPGFLKLKIQSTYGPPVAFVDFQVTCVC 153