BLASTX nr result
ID: Panax24_contig00019164
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00019164 (1077 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017243369.1 PREDICTED: disease resistance protein RGA2-like [... 67 1e-08 >XP_017243369.1 PREDICTED: disease resistance protein RGA2-like [Daucus carota subsp. sativus] KZN02125.1 hypothetical protein DCAR_010879 [Daucus carota subsp. sativus] Length = 862 Score = 67.4 bits (163), Expect = 1e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +1 Query: 850 YDQMRTDLKQCFAYCSIFLKDCHIPRKELINLWIS 954 YDQMRT LKQCF+YCSIF KD HIPR+ELINLWI+ Sbjct: 383 YDQMRTSLKQCFSYCSIFPKDYHIPREELINLWIA 417