BLASTX nr result
ID: Panax24_contig00019137
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00019137 (462 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_002316654.1 hypothetical protein POPTR_0011s04320g [Populus t... 56 7e-16 XP_007212076.1 hypothetical protein PRUPE_ppa011686mg [Prunus pe... 56 3e-15 XP_010265474.1 PREDICTED: ribosomal RNA-processing protein 17 [N... 59 4e-14 XP_004287393.1 PREDICTED: ribosomal RNA-processing protein 17-li... 57 1e-13 XP_011653832.1 PREDICTED: ribosomal RNA-processing protein 17 [C... 59 2e-13 GAU45094.1 hypothetical protein TSUD_85800, partial [Trifolium s... 52 2e-10 XP_006467891.1 PREDICTED: ribosomal RNA-processing protein 17 is... 64 3e-10 KDO75737.1 hypothetical protein CISIN_1g029079mg [Citrus sinensis] 64 9e-10 XP_006467890.1 PREDICTED: ribosomal RNA-processing protein 17 is... 64 9e-10 XP_006449223.1 hypothetical protein CICLE_v10016776mg [Citrus cl... 64 9e-10 XP_017234943.1 PREDICTED: ribosomal RNA-processing protein 17 [D... 64 9e-10 XP_006650088.1 PREDICTED: ribosomal RNA-processing protein 17 [O... 48 2e-09 XP_010042845.1 PREDICTED: ribosomal RNA-processing protein 17-li... 63 4e-09 OAY26097.1 hypothetical protein MANES_16G021000 [Manihot esculenta] 61 5e-09 XP_016433977.1 PREDICTED: ribosomal RNA-processing protein 17-li... 62 5e-09 XP_009606925.1 PREDICTED: ribosomal RNA-processing protein 17 [N... 62 5e-09 XP_006361014.1 PREDICTED: ribosomal RNA-processing protein 17 [S... 62 5e-09 XP_010052378.1 PREDICTED: ribosomal RNA-processing protein 17 [E... 62 7e-09 KDP20891.1 hypothetical protein JCGZ_21362 [Jatropha curcas] 62 8e-09 KZV48615.1 ribosomal RNA-processing protein 17 [Dorcoceras hygro... 62 8e-09 >XP_002316654.1 hypothetical protein POPTR_0011s04320g [Populus trichocarpa] EEE97266.1 hypothetical protein POPTR_0011s04320g [Populus trichocarpa] Length = 196 Score = 56.2 bits (134), Expect(2) = 7e-16 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -3 Query: 370 PHIRARHIKKRALKNKALSVSFSEKDLKDYVTGF 269 P RA HIKKR LKNK +SVSF+EKDL+DYVTGF Sbjct: 14 PPTRAGHIKKRVLKNKGVSVSFNEKDLRDYVTGF 47 Score = 54.7 bits (130), Expect(2) = 7e-16 Identities = 37/92 (40%), Positives = 48/92 (52%), Gaps = 1/92 (1%) Frame = -1 Query: 273 VSIRGRRRGEKKLNINNRKQNGASVSRNANRGNWKENLCRMEXXXXXXXIQSVSGTMMYD 94 ++ R +R+ EK+L +N A S N E I S+SGT YD Sbjct: 71 IAARKQRKLEKELALNGGAPPAADESDNYG-----------EDDEEIEPIASISGTTKYD 119 Query: 93 NGDVKVTVTTSEISHE-EELPSEKPEAVAPRL 1 NGD++VTVTTSEIS E E+ SEK + PRL Sbjct: 120 NGDMQVTVTTSEISREDEDGHSEKTQVTVPRL 151 >XP_007212076.1 hypothetical protein PRUPE_ppa011686mg [Prunus persica] ONI10239.1 hypothetical protein PRUPE_4G036300 [Prunus persica] Length = 200 Score = 55.8 bits (133), Expect(2) = 3e-15 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -3 Query: 370 PHIRARHIKKRALKNKALSVSFSEKDLKDYVTGF 269 P+ R RHIKKRALKNKAL+V+F+EKDL D+V+GF Sbjct: 13 PNPRGRHIKKRALKNKALAVTFNEKDLSDFVSGF 46 Score = 52.8 bits (125), Expect(2) = 3e-15 Identities = 37/91 (40%), Positives = 48/91 (52%), Gaps = 1/91 (1%) Frame = -1 Query: 273 VSIRGRRRGEKKLNINNRKQNGASVSRNANRGNWKENLCRMEXXXXXXXIQSVSGTMMYD 94 + +R +RR EK+L +N+ + + E+ E VSGT YD Sbjct: 70 LELRKKRRLEKELALNDDAPPATDTAAD-------ESDEHDEDDESSEPALPVSGTTTYD 122 Query: 93 NGDVKVTVTTSEISHEEELPS-EKPEAVAPR 4 NGD+KVTVTTSEIS EEE S EK EA P+ Sbjct: 123 NGDMKVTVTTSEISREEESDSDEKTEAAIPQ 153 >XP_010265474.1 PREDICTED: ribosomal RNA-processing protein 17 [Nelumbo nucifera] Length = 200 Score = 59.3 bits (142), Expect(2) = 4e-14 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 370 PHIRARHIKKRALKNKALSVSFSEKDLKDYVTGF 269 P ARHIKKRALKNKALSV+F+EKDL+D+VTGF Sbjct: 13 PRTNARHIKKRALKNKALSVTFNEKDLRDFVTGF 46 Score = 45.8 bits (107), Expect(2) = 4e-14 Identities = 30/87 (34%), Positives = 44/87 (50%) Frame = -1 Query: 264 RGRRRGEKKLNINNRKQNGASVSRNANRGNWKENLCRMEXXXXXXXIQSVSGTMMYDNGD 85 R + R ++KL + GA + +A +++ + E I SV GT MYDNGD Sbjct: 69 RIQARKQRKLERDLALYGGAQPATDAGVDEGGDDIDQEEGTDPTTSI-SVEGTSMYDNGD 127 Query: 84 VKVTVTTSEISHEEELPSEKPEAVAPR 4 + +TVT SEIS EE+ + PR Sbjct: 128 MTITVTMSEISREEDADLRPKTQLIPR 154 >XP_004287393.1 PREDICTED: ribosomal RNA-processing protein 17-like [Fragaria vesca subsp. vesca] Length = 204 Score = 57.4 bits (137), Expect(2) = 1e-13 Identities = 38/91 (41%), Positives = 48/91 (52%), Gaps = 1/91 (1%) Frame = -1 Query: 276 LVSIRGRRRGEKKLNINNRKQNGASVSRNANRGNWKENLCRMEXXXXXXXIQSVSGTMMY 97 L+ +R +RR EK+L + GA + E E +SGT Y Sbjct: 70 LLELRKKRRLEKELALFG----GAPPAAEGEADENDEGDASQEEDEESEPDALISGTTTY 125 Query: 96 DNGDVKVTVTTSEISHEEEL-PSEKPEAVAP 7 DNGD+KVTVTTSEIS EEE+ P +K EAV P Sbjct: 126 DNGDIKVTVTTSEISQEEEIHPVKKTEAVVP 156 Score = 45.8 bits (107), Expect(2) = 1e-13 Identities = 19/31 (61%), Positives = 27/31 (87%) Frame = -3 Query: 361 RARHIKKRALKNKALSVSFSEKDLKDYVTGF 269 R R++ KRALKNKA++V+F+EK L D+V+GF Sbjct: 17 RGRYVNKRALKNKAVAVTFNEKSLSDFVSGF 47 >XP_011653832.1 PREDICTED: ribosomal RNA-processing protein 17 [Cucumis sativus] KGN54640.1 hypothetical protein Csa_4G414400 [Cucumis sativus] Length = 196 Score = 59.3 bits (142), Expect(2) = 2e-13 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -3 Query: 370 PHIRARHIKKRALKNKALSVSFSEKDLKDYVTGF 269 PH ARHIKKRAL+NKALSVSF+EKDL+DYVTGF Sbjct: 15 PH--ARHIKKRALRNKALSVSFNEKDLRDYVTGF 46 Score = 43.5 bits (101), Expect(2) = 2e-13 Identities = 30/88 (34%), Positives = 48/88 (54%), Gaps = 3/88 (3%) Frame = -1 Query: 273 VSIRGRRRGEKKLNINNR--KQNGASVSRNANRGNWKENLCRMEXXXXXXXIQSVSGTMM 100 + R +R+ EK L ++ + A +N ++GN +E + +S Sbjct: 70 IEARKKRKLEKDLVLHGGVLPADRAVDDQNDDQGNEEEE-----------PLAPLSEATT 118 Query: 99 YDNGDVKVTVTTSEISHEEEL-PSEKPE 19 YDNG+VKVTVTTSE+S E+E+ P +KP+ Sbjct: 119 YDNGNVKVTVTTSEVSREDEIDPIDKPQ 146 >GAU45094.1 hypothetical protein TSUD_85800, partial [Trifolium subterraneum] Length = 192 Score = 52.0 bits (123), Expect(2) = 2e-10 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -3 Query: 352 HIKKRALKNKALSVSFSEKDLKDYVTGF 269 H+KKRALKNKAL ++F EKDLKD+VTGF Sbjct: 31 HVKKRALKNKALGITFDEKDLKDFVTGF 58 Score = 40.4 bits (93), Expect(2) = 2e-10 Identities = 29/86 (33%), Positives = 42/86 (48%), Gaps = 2/86 (2%) Frame = -1 Query: 267 IRGRRRGEKKLNINNRKQNGASVSRNANRGNWKENLCR-MEXXXXXXXIQSVSGTMMYDN 91 + G + +KK +KQ + R N K L R + ++ + T Y+N Sbjct: 55 VTGFHKRKKKRRKVAQKQQEEAKRRKRNEERLKRKLERELAYGGVPPTDETEAATKTYEN 114 Query: 90 GDVKVTVTTSEISHEEE-LPSEKPEA 16 D+KVTV T EI+ EEE PSE+ EA Sbjct: 115 DDLKVTVVTKEINPEEESFPSERKEA 140 >XP_006467891.1 PREDICTED: ribosomal RNA-processing protein 17 isoform X2 [Citrus sinensis] Length = 134 Score = 64.3 bits (155), Expect = 3e-10 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -3 Query: 370 PHIRARHIKKRALKNKALSVSFSEKDLKDYVTGF 269 P +R RHIKKRALKNKALSVSF EKDLKDYVTGF Sbjct: 13 PKVRGRHIKKRALKNKALSVSFDEKDLKDYVTGF 46 >KDO75737.1 hypothetical protein CISIN_1g029079mg [Citrus sinensis] Length = 199 Score = 64.3 bits (155), Expect = 9e-10 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -3 Query: 370 PHIRARHIKKRALKNKALSVSFSEKDLKDYVTGF 269 P +R RHIKKRALKNKALSVSF EKDLKDYVTGF Sbjct: 13 PKVRGRHIKKRALKNKALSVSFDEKDLKDYVTGF 46 Score = 57.0 bits (136), Expect = 5e-07 Identities = 28/38 (73%), Positives = 31/38 (81%), Gaps = 1/38 (2%) Frame = -1 Query: 117 VSGTMMYDNGDVKVTVTTSEISHE-EELPSEKPEAVAP 7 ++GT MYDNGD+KVTVTTSEISHE E LPSEK A P Sbjct: 115 ITGTTMYDNGDLKVTVTTSEISHEAENLPSEKTPAAVP 152 >XP_006467890.1 PREDICTED: ribosomal RNA-processing protein 17 isoform X1 [Citrus sinensis] Length = 199 Score = 64.3 bits (155), Expect = 9e-10 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -3 Query: 370 PHIRARHIKKRALKNKALSVSFSEKDLKDYVTGF 269 P +R RHIKKRALKNKALSVSF EKDLKDYVTGF Sbjct: 13 PKVRGRHIKKRALKNKALSVSFDEKDLKDYVTGF 46 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/41 (65%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = -1 Query: 126 IQSVSGTMMYDNGDVKVTVTTSEISHE-EELPSEKPEAVAP 7 + ++GT MYDNGD++VTVTTSEISHE E LPSEK A P Sbjct: 112 VAPIAGTTMYDNGDLEVTVTTSEISHEAENLPSEKTPAAVP 152 >XP_006449223.1 hypothetical protein CICLE_v10016776mg [Citrus clementina] ESR62463.1 hypothetical protein CICLE_v10016776mg [Citrus clementina] Length = 199 Score = 64.3 bits (155), Expect = 9e-10 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -3 Query: 370 PHIRARHIKKRALKNKALSVSFSEKDLKDYVTGF 269 P +R RHIKKRALKNKALSVSF EKDLKDYVTGF Sbjct: 13 PKVRGRHIKKRALKNKALSVSFDEKDLKDYVTGF 46 >XP_017234943.1 PREDICTED: ribosomal RNA-processing protein 17 [Daucus carota subsp. sativus] KZN07230.1 hypothetical protein DCAR_008067 [Daucus carota subsp. sativus] Length = 200 Score = 64.3 bits (155), Expect = 9e-10 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -3 Query: 370 PHIRARHIKKRALKNKALSVSFSEKDLKDYVTGF 269 PHIRA HIKKRALKNK+LS+SF+EKDL DYVTGF Sbjct: 13 PHIRANHIKKRALKNKSLSISFNEKDLTDYVTGF 46 Score = 56.2 bits (134), Expect = 9e-07 Identities = 31/43 (72%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = -1 Query: 126 IQSVSGTMMYDNGDVKVTVTTSEIS-HEEELPSEKPEAVAPRL 1 I +VSGT MYDNGDVKV VTTSEI+ EEEL SEK E PRL Sbjct: 111 IATVSGTTMYDNGDVKVVVTTSEINDDEEELKSEKMEGDVPRL 153 >XP_006650088.1 PREDICTED: ribosomal RNA-processing protein 17 [Oryza brachyantha] Length = 228 Score = 48.1 bits (113), Expect(2) = 2e-09 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = -3 Query: 355 RHIKKRALKNKALSVSFSEKDLKDYVTGF 269 +HIKKR+LKNKALSVS +K LKD+VTGF Sbjct: 39 KHIKKRSLKNKALSVSLDKKALKDFVTGF 67 Score = 40.8 bits (94), Expect(2) = 2e-09 Identities = 29/86 (33%), Positives = 45/86 (52%) Frame = -1 Query: 264 RGRRRGEKKLNINNRKQNGASVSRNANRGNWKENLCRMEXXXXXXXIQSVSGTMMYDNGD 85 R RR+ EK++ + R + S NA+ +++ + ME S Y++G Sbjct: 94 RKRRKQEKEIALYGRVLS----SDNADGEDFENDGDEMETDDLP-----ASEVRTYEDGG 144 Query: 84 VKVTVTTSEISHEEELPSEKPEAVAP 7 K+TVTTSEI+HEE+ P+ VAP Sbjct: 145 TKITVTTSEITHEEDDDDLGPKRVAP 170 >XP_010042845.1 PREDICTED: ribosomal RNA-processing protein 17-like [Eucalyptus grandis] Length = 205 Score = 62.8 bits (151), Expect = 4e-09 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -3 Query: 370 PHIRARHIKKRALKNKALSVSFSEKDLKDYVTGF 269 P +R RHIKKRALKNKALSV+F+EKDL+DYVTGF Sbjct: 17 PRVRGRHIKKRALKNKALSVAFNEKDLRDYVTGF 50 >OAY26097.1 hypothetical protein MANES_16G021000 [Manihot esculenta] Length = 144 Score = 61.2 bits (147), Expect = 5e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -3 Query: 370 PHIRARHIKKRALKNKALSVSFSEKDLKDYVTGF 269 P IRA HIKKRALKNKAL+VSF+EKDL+DYVTGF Sbjct: 12 PPIRAPHIKKRALKNKALAVSFNEKDLRDYVTGF 45 >XP_016433977.1 PREDICTED: ribosomal RNA-processing protein 17-like [Nicotiana tabacum] XP_016433978.1 PREDICTED: ribosomal RNA-processing protein 17-like [Nicotiana tabacum] XP_016433979.1 PREDICTED: ribosomal RNA-processing protein 17-like [Nicotiana tabacum] Length = 205 Score = 62.4 bits (150), Expect = 5e-09 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -3 Query: 370 PHIRARHIKKRALKNKALSVSFSEKDLKDYVTGF 269 P IR RHIKKRALKNKAL+VSF EKDLKD+VTGF Sbjct: 17 PRIRGRHIKKRALKNKALTVSFDEKDLKDFVTGF 50 >XP_009606925.1 PREDICTED: ribosomal RNA-processing protein 17 [Nicotiana tomentosiformis] XP_018627950.1 PREDICTED: ribosomal RNA-processing protein 17 [Nicotiana tomentosiformis] Length = 205 Score = 62.4 bits (150), Expect = 5e-09 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -3 Query: 370 PHIRARHIKKRALKNKALSVSFSEKDLKDYVTGF 269 P IR RHIKKRALKNKAL+VSF EKDLKD+VTGF Sbjct: 17 PRIRGRHIKKRALKNKALTVSFDEKDLKDFVTGF 50 >XP_006361014.1 PREDICTED: ribosomal RNA-processing protein 17 [Solanum tuberosum] Length = 206 Score = 62.4 bits (150), Expect = 5e-09 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -3 Query: 370 PHIRARHIKKRALKNKALSVSFSEKDLKDYVTGF 269 P IR RHIKKRALKNKAL+VSF EKDLKD+VTGF Sbjct: 15 PRIRGRHIKKRALKNKALTVSFDEKDLKDFVTGF 48 >XP_010052378.1 PREDICTED: ribosomal RNA-processing protein 17 [Eucalyptus grandis] KCW76339.1 hypothetical protein EUGRSUZ_D00710 [Eucalyptus grandis] Length = 205 Score = 62.0 bits (149), Expect = 7e-09 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -3 Query: 370 PHIRARHIKKRALKNKALSVSFSEKDLKDYVTGF 269 P IR RHIKKRALKNKAL+V+F+EKDL+DYVTGF Sbjct: 17 PRIRGRHIKKRALKNKALAVAFNEKDLRDYVTGF 50 >KDP20891.1 hypothetical protein JCGZ_21362 [Jatropha curcas] Length = 195 Score = 61.6 bits (148), Expect = 8e-09 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -3 Query: 370 PHIRARHIKKRALKNKALSVSFSEKDLKDYVTGF 269 P +RARHI KRALKNKAL+VSF+EKDL+DYVTGF Sbjct: 13 PAVRARHINKRALKNKALAVSFNEKDLRDYVTGF 46 >KZV48615.1 ribosomal RNA-processing protein 17 [Dorcoceras hygrometricum] Length = 196 Score = 61.6 bits (148), Expect = 8e-09 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -3 Query: 370 PHIRARHIKKRALKNKALSVSFSEKDLKDYVTGF 269 P +R+RHIKKRALKNK+LSVSF+EKDLKD+VTGF Sbjct: 13 PLVRSRHIKKRALKNKSLSVSFNEKDLKDFVTGF 46