BLASTX nr result
ID: Panax24_contig00018367
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00018367 (515 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN09403.1 hypothetical protein DCAR_002059 [Daucus carota subsp... 54 9e-07 >KZN09403.1 hypothetical protein DCAR_002059 [Daucus carota subsp. sativus] Length = 61 Score = 53.5 bits (127), Expect = 9e-07 Identities = 30/60 (50%), Positives = 38/60 (63%) Frame = -3 Query: 399 LFFLILAVAARYTTSVAVAQEIDLAPAPAPIMMQSAAGYPAMSGAFAFISLFLSFVSLIW 220 +FF + VA + A QE+DLAPAPAP M SAA YPA A AF+S+ FV+L+W Sbjct: 8 IFFFVFVVACM---TAAAGQELDLAPAPAP-SMDSAASYPAAGAAVAFVSM---FVALLW 60