BLASTX nr result
ID: Panax24_contig00018233
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00018233 (633 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN03382.1 hypothetical protein DCAR_012138 [Daucus carota subsp... 56 7e-06 XP_017242993.1 PREDICTED: uncharacterized protein LOC108215142 [... 56 9e-06 >KZN03382.1 hypothetical protein DCAR_012138 [Daucus carota subsp. sativus] Length = 268 Score = 55.8 bits (133), Expect = 7e-06 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = -3 Query: 622 SGSNRVFRKDGPFSRGMRPQKLEGSNSEFYDMSLQHDGSYGFQEGN 485 SG RV +KDG F +GM ++++ +NSE YDM LQ DGSY F+E N Sbjct: 222 SGRTRVVKKDGSFGKGMHKREVKVANSEVYDMDLQRDGSYWFKEQN 267 >XP_017242993.1 PREDICTED: uncharacterized protein LOC108215142 [Daucus carota subsp. sativus] Length = 320 Score = 55.8 bits (133), Expect = 9e-06 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = -3 Query: 622 SGSNRVFRKDGPFSRGMRPQKLEGSNSEFYDMSLQHDGSYGFQEGN 485 SG RV +KDG F +GM ++++ +NSE YDM LQ DGSY F+E N Sbjct: 274 SGRTRVVKKDGSFGKGMHKREVKVANSEVYDMDLQRDGSYWFKEQN 319