BLASTX nr result
ID: Panax24_contig00018032
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00018032 (419 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009588733.2 PREDICTED: transcription-associated protein 1-lik... 69 9e-11 XP_016480420.1 PREDICTED: probable transcription-associated prot... 69 9e-11 XP_016485173.1 PREDICTED: transformation/transcription domain-as... 69 9e-11 CDP01903.1 unnamed protein product [Coffea canephora] 69 9e-11 XP_019172187.1 PREDICTED: transformation/transcription domain-as... 69 9e-11 XP_019172186.1 PREDICTED: transformation/transcription domain-as... 69 9e-11 XP_019254936.1 PREDICTED: transformation/transcription domain-as... 69 9e-11 XP_009768502.1 PREDICTED: transformation/transcription domain-as... 69 9e-11 XP_019254934.1 PREDICTED: transformation/transcription domain-as... 69 9e-11 XP_009768501.1 PREDICTED: transformation/transcription domain-as... 69 9e-11 OAY74174.1 Transformation/transcription domain-associated protei... 68 1e-10 CBI17379.3 unnamed protein product, partial [Vitis vinifera] 68 1e-10 OIV92684.1 hypothetical protein TanjilG_18035 [Lupinus angustifo... 68 1e-10 XP_019423288.1 PREDICTED: transformation/transcription domain-as... 68 1e-10 KMT09615.1 hypothetical protein BVRB_6g130680 [Beta vulgaris sub... 68 1e-10 XP_010938881.1 PREDICTED: transformation/transcription domain-as... 68 1e-10 XP_004134864.1 PREDICTED: transformation/transcription domain-as... 68 1e-10 XP_008440816.1 PREDICTED: transformation/transcription domain-as... 68 1e-10 XP_010268349.1 PREDICTED: transformation/transcription domain-as... 68 1e-10 XP_010938880.1 PREDICTED: transformation/transcription domain-as... 68 1e-10 >XP_009588733.2 PREDICTED: transcription-associated protein 1-like [Nicotiana tomentosiformis] Length = 1775 Score = 68.6 bits (166), Expect = 9e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 10 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV 102 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV Sbjct: 1372 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV 1402 >XP_016480420.1 PREDICTED: probable transcription-associated protein 1 [Nicotiana tabacum] Length = 2973 Score = 68.6 bits (166), Expect = 9e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 10 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV 102 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV Sbjct: 2570 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV 2600 >XP_016485173.1 PREDICTED: transformation/transcription domain-associated protein-like [Nicotiana tabacum] Length = 3823 Score = 68.6 bits (166), Expect = 9e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 10 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV 102 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV Sbjct: 3420 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV 3450 >CDP01903.1 unnamed protein product [Coffea canephora] Length = 3863 Score = 68.6 bits (166), Expect = 9e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 10 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV 102 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV Sbjct: 3460 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV 3490 >XP_019172187.1 PREDICTED: transformation/transcription domain-associated protein-like isoform X2 [Ipomoea nil] Length = 3880 Score = 68.6 bits (166), Expect = 9e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 10 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV 102 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV Sbjct: 3477 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV 3507 >XP_019172186.1 PREDICTED: transformation/transcription domain-associated protein-like isoform X1 [Ipomoea nil] Length = 3900 Score = 68.6 bits (166), Expect = 9e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 10 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV 102 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV Sbjct: 3497 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV 3527 >XP_019254936.1 PREDICTED: transformation/transcription domain-associated protein-like isoform X2 [Nicotiana attenuata] OIS98253.1 serinethreonine-protein kinase atr [Nicotiana attenuata] Length = 3906 Score = 68.6 bits (166), Expect = 9e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 10 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV 102 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV Sbjct: 3503 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV 3533 >XP_009768502.1 PREDICTED: transformation/transcription domain-associated protein-like isoform X2 [Nicotiana sylvestris] Length = 3907 Score = 68.6 bits (166), Expect = 9e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 10 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV 102 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV Sbjct: 3504 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV 3534 >XP_019254934.1 PREDICTED: transformation/transcription domain-associated protein-like isoform X1 [Nicotiana attenuata] Length = 3909 Score = 68.6 bits (166), Expect = 9e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 10 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV 102 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV Sbjct: 3506 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV 3536 >XP_009768501.1 PREDICTED: transformation/transcription domain-associated protein-like isoform X1 [Nicotiana sylvestris] Length = 3910 Score = 68.6 bits (166), Expect = 9e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 10 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV 102 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV Sbjct: 3507 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV 3537 >OAY74174.1 Transformation/transcription domain-associated protein [Ananas comosus] Length = 3484 Score = 68.2 bits (165), Expect = 1e-10 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 10 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV 102 RDFHVVDVEVPGQYFTDQEVAPDHT+KLDRV Sbjct: 3122 RDFHVVDVEVPGQYFTDQEVAPDHTIKLDRV 3152 >CBI17379.3 unnamed protein product, partial [Vitis vinifera] Length = 3681 Score = 68.2 bits (165), Expect = 1e-10 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 10 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV 102 RDFHVVDVEVPGQYFTDQE+APDHTVKLDRV Sbjct: 3278 RDFHVVDVEVPGQYFTDQEIAPDHTVKLDRV 3308 >OIV92684.1 hypothetical protein TanjilG_18035 [Lupinus angustifolius] Length = 3814 Score = 68.2 bits (165), Expect = 1e-10 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 10 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV 102 RDFHV+DVEVPGQYFTDQEVAPDHTVKLDRV Sbjct: 3412 RDFHVIDVEVPGQYFTDQEVAPDHTVKLDRV 3442 >XP_019423288.1 PREDICTED: transformation/transcription domain-associated protein-like [Lupinus angustifolius] XP_019423289.1 PREDICTED: transformation/transcription domain-associated protein-like [Lupinus angustifolius] Length = 3872 Score = 68.2 bits (165), Expect = 1e-10 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 10 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV 102 RDFHV+DVEVPGQYFTDQEVAPDHTVKLDRV Sbjct: 3470 RDFHVIDVEVPGQYFTDQEVAPDHTVKLDRV 3500 >KMT09615.1 hypothetical protein BVRB_6g130680 [Beta vulgaris subsp. vulgaris] Length = 3874 Score = 68.2 bits (165), Expect = 1e-10 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 10 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV 102 RDFHVVDVEVPGQYFTDQE+APDHTVKLDRV Sbjct: 3472 RDFHVVDVEVPGQYFTDQEIAPDHTVKLDRV 3502 >XP_010938881.1 PREDICTED: transformation/transcription domain-associated protein-like isoform X2 [Elaeis guineensis] Length = 3885 Score = 68.2 bits (165), Expect = 1e-10 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 10 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV 102 RDFHVVDVEVPGQYFTDQEVAPDHT+KLDRV Sbjct: 3484 RDFHVVDVEVPGQYFTDQEVAPDHTIKLDRV 3514 >XP_004134864.1 PREDICTED: transformation/transcription domain-associated protein [Cucumis sativus] XP_011658043.1 PREDICTED: transformation/transcription domain-associated protein [Cucumis sativus] KGN48912.1 hypothetical protein Csa_6G505900 [Cucumis sativus] Length = 3889 Score = 68.2 bits (165), Expect = 1e-10 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 10 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV 102 RDFHVVDVEVPGQYFTDQE+APDHTVKLDRV Sbjct: 3487 RDFHVVDVEVPGQYFTDQEIAPDHTVKLDRV 3517 >XP_008440816.1 PREDICTED: transformation/transcription domain-associated protein-like [Cucumis melo] Length = 3890 Score = 68.2 bits (165), Expect = 1e-10 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 10 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV 102 RDFHVVDVEVPGQYFTDQE+APDHTVKLDRV Sbjct: 3488 RDFHVVDVEVPGQYFTDQEIAPDHTVKLDRV 3518 >XP_010268349.1 PREDICTED: transformation/transcription domain-associated protein-like [Nelumbo nucifera] Length = 3896 Score = 68.2 bits (165), Expect = 1e-10 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 10 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV 102 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDR+ Sbjct: 3493 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRI 3523 >XP_010938880.1 PREDICTED: transformation/transcription domain-associated protein-like isoform X1 [Elaeis guineensis] Length = 3898 Score = 68.2 bits (165), Expect = 1e-10 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 10 RDFHVVDVEVPGQYFTDQEVAPDHTVKLDRV 102 RDFHVVDVEVPGQYFTDQEVAPDHT+KLDRV Sbjct: 3497 RDFHVVDVEVPGQYFTDQEVAPDHTIKLDRV 3527