BLASTX nr result
ID: Panax24_contig00018022
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00018022 (359 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017216668.1 PREDICTED: histone chaperone ASF1B [Daucus carota... 79 8e-16 XP_002266119.1 PREDICTED: histone chaperone ASF1B [Vitis vinifer... 78 1e-15 XP_006344201.1 PREDICTED: probable histone chaperone ASF1A [Sola... 78 1e-15 XP_009765801.1 PREDICTED: histone chaperone ASF1B-like [Nicotian... 77 3e-15 XP_016546606.1 PREDICTED: probable histone chaperone ASF1A [Caps... 77 3e-15 XP_019266089.1 PREDICTED: histone chaperone ASF1B-like [Nicotian... 77 6e-15 XP_012854521.1 PREDICTED: probable histone chaperone ASF1A [Eryt... 76 9e-15 CDP02737.1 unnamed protein product [Coffea canephora] 75 2e-14 KVI02782.1 Histone chaperone, ASF1-like protein [Cynara carduncu... 75 3e-14 XP_009600274.1 PREDICTED: histone chaperone ASF1B-like [Nicotian... 75 3e-14 XP_011099509.1 PREDICTED: probable histone chaperone ASF1A [Sesa... 75 3e-14 XP_011035137.1 PREDICTED: histone chaperone ASF1B-like [Populus ... 74 4e-14 OIW14707.1 hypothetical protein TanjilG_33049 [Lupinus angustifo... 74 8e-14 XP_019438250.1 PREDICTED: histone chaperone ASF1B-like [Lupinus ... 74 8e-14 XP_004238871.1 PREDICTED: probable histone chaperone ASF1A [Sola... 74 9e-14 GAV87474.1 ASF1_hist_chap domain-containing protein, partial [Ce... 73 2e-13 XP_015074951.1 PREDICTED: probable histone chaperone ASF1A [Sola... 73 2e-13 XP_018816794.1 PREDICTED: probable histone chaperone ASF1A [Jugl... 72 2e-13 XP_002528058.1 PREDICTED: probable histone chaperone ASF1A [Rici... 72 2e-13 XP_015065132.1 PREDICTED: probable histone chaperone ASF1A [Sola... 72 3e-13 >XP_017216668.1 PREDICTED: histone chaperone ASF1B [Daucus carota subsp. sativus] KZM88815.1 hypothetical protein DCAR_025890 [Daucus carota subsp. sativus] Length = 197 Score = 79.0 bits (193), Expect = 8e-16 Identities = 41/60 (68%), Positives = 45/60 (75%), Gaps = 5/60 (8%) Frame = +1 Query: 1 KVQRNILTDKPRVTKFPINFHPENNESGEQATPV--DNPAEADVIEEPPPS---STADKD 165 KVQRNILTDKPRVTKFPINFHPENNE GEQA +PAEAD +EE P+ ADK+ Sbjct: 134 KVQRNILTDKPRVTKFPINFHPENNEGGEQAEQASPSHPAEADAVEEQTPTLLEPPADKE 193 >XP_002266119.1 PREDICTED: histone chaperone ASF1B [Vitis vinifera] CBI33597.3 unnamed protein product, partial [Vitis vinifera] Length = 193 Score = 78.2 bits (191), Expect = 1e-15 Identities = 35/51 (68%), Positives = 41/51 (80%) Frame = +1 Query: 1 KVQRNILTDKPRVTKFPINFHPENNESGEQATPVDNPAEADVIEEPPPSST 153 +VQRNIL+DKPRVTKFPINFHPEN + G+Q P D+PAE D E PP+ST Sbjct: 134 RVQRNILSDKPRVTKFPINFHPENKDPGDQPPPPDHPAETDGNREEPPAST 184 >XP_006344201.1 PREDICTED: probable histone chaperone ASF1A [Solanum tuberosum] Length = 194 Score = 78.2 bits (191), Expect = 1e-15 Identities = 36/50 (72%), Positives = 39/50 (78%) Frame = +1 Query: 1 KVQRNILTDKPRVTKFPINFHPENNESGEQATPVDNPAEADVIEEPPPSS 150 ++QRNIL DKPRVTKFPINFHPENNE GEQA P DN E V+ E P SS Sbjct: 134 RIQRNILVDKPRVTKFPINFHPENNEDGEQAPPPDNATEEKVLGEEPVSS 183 >XP_009765801.1 PREDICTED: histone chaperone ASF1B-like [Nicotiana sylvestris] XP_016451190.1 PREDICTED: histone chaperone ASF1B-like [Nicotiana tabacum] Length = 192 Score = 77.4 bits (189), Expect = 3e-15 Identities = 38/58 (65%), Positives = 46/58 (79%), Gaps = 2/58 (3%) Frame = +1 Query: 1 KVQRNILTDKPRVTKFPINFHPENNESGEQATPVDNPAEADVIEE--PPPSSTADKDG 168 K+QRNIL+DKPRVTKFPINFHPEN+ESGEQA P D+ AEA E+ P P + +D+ G Sbjct: 134 KIQRNILSDKPRVTKFPINFHPENSESGEQAPPTDHVAEAAGNEDQLPSPKNGSDEAG 191 >XP_016546606.1 PREDICTED: probable histone chaperone ASF1A [Capsicum annuum] Length = 194 Score = 77.4 bits (189), Expect = 3e-15 Identities = 36/50 (72%), Positives = 41/50 (82%) Frame = +1 Query: 1 KVQRNILTDKPRVTKFPINFHPENNESGEQATPVDNPAEADVIEEPPPSS 150 +VQRNIL DKPRVTKFPINFHPEN+E+GEQA P DN E +V+ E P SS Sbjct: 134 RVQRNILVDKPRVTKFPINFHPENDENGEQAPPPDNTEEENVLGEEPVSS 183 >XP_019266089.1 PREDICTED: histone chaperone ASF1B-like [Nicotiana attenuata] OIT35266.1 histone chaperone asf1b [Nicotiana attenuata] Length = 192 Score = 76.6 bits (187), Expect = 6e-15 Identities = 37/58 (63%), Positives = 46/58 (79%), Gaps = 2/58 (3%) Frame = +1 Query: 1 KVQRNILTDKPRVTKFPINFHPENNESGEQATPVDNPAEA--DVIEEPPPSSTADKDG 168 K+QRNIL+DKPRVTKFPINFHPEN+ESGEQA P D+ AEA + + P P + +D+ G Sbjct: 134 KIQRNILSDKPRVTKFPINFHPENSESGEQAPPTDHVAEAAGNAEQLPSPKNGSDEAG 191 >XP_012854521.1 PREDICTED: probable histone chaperone ASF1A [Erythranthe guttata] EYU44599.1 hypothetical protein MIMGU_mgv1a014184mg [Erythranthe guttata] Length = 198 Score = 76.3 bits (186), Expect = 9e-15 Identities = 35/51 (68%), Positives = 41/51 (80%) Frame = +1 Query: 1 KVQRNILTDKPRVTKFPINFHPENNESGEQATPVDNPAEADVIEEPPPSST 153 ++QRNIL+DKPRVTKFPINFHPEN+E+GEQA P D AE D +EE ST Sbjct: 134 RIQRNILSDKPRVTKFPINFHPENSETGEQALPPDQVAEGDGVEEERQPST 184 >CDP02737.1 unnamed protein product [Coffea canephora] Length = 217 Score = 75.5 bits (184), Expect = 2e-14 Identities = 36/56 (64%), Positives = 42/56 (75%) Frame = +1 Query: 1 KVQRNILTDKPRVTKFPINFHPENNESGEQATPVDNPAEADVIEEPPPSSTADKDG 168 +VQRNILTDKPRVTKFPINFHPEN+ESGEQ P ++ AE + E+ P S DG Sbjct: 160 RVQRNILTDKPRVTKFPINFHPENSESGEQGPPPEHAAEPEANEQVPASPGHLSDG 215 >KVI02782.1 Histone chaperone, ASF1-like protein [Cynara cardunculus var. scolymus] Length = 184 Score = 74.7 bits (182), Expect = 3e-14 Identities = 37/50 (74%), Positives = 40/50 (80%) Frame = +1 Query: 1 KVQRNILTDKPRVTKFPINFHPENNESGEQATPVDNPAEADVIEEPPPSS 150 KVQRNILTDKPRVTKFPINFHPENNESGEQA P A+ E+ PP+S Sbjct: 134 KVQRNILTDKPRVTKFPINFHPENNESGEQAP----PPVAETSEQQPPNS 179 >XP_009600274.1 PREDICTED: histone chaperone ASF1B-like [Nicotiana tomentosiformis] XP_016445806.1 PREDICTED: histone chaperone ASF1B-like [Nicotiana tabacum] Length = 193 Score = 74.7 bits (182), Expect = 3e-14 Identities = 38/59 (64%), Positives = 45/59 (76%), Gaps = 3/59 (5%) Frame = +1 Query: 1 KVQRNILTDKPRVTKFPINFHPENNESGEQATPVDNPAEADVIEE---PPPSSTADKDG 168 K+QRNIL+DKPRVTKFPINFHPEN+ESGEQA D+ AEA EE P P + +D+ G Sbjct: 134 KIQRNILSDKPRVTKFPINFHPENSESGEQAPSSDHVAEAAGNEEQQLPSPKNDSDEAG 192 >XP_011099509.1 PREDICTED: probable histone chaperone ASF1A [Sesamum indicum] Length = 194 Score = 74.7 bits (182), Expect = 3e-14 Identities = 35/58 (60%), Positives = 46/58 (79%), Gaps = 3/58 (5%) Frame = +1 Query: 1 KVQRNILTDKPRVTKFPINFHPENNESGEQATPVDNPAEADVIEE---PPPSSTADKD 165 ++QRNIL+DKPRVTKFPINFHPEN+E+GEQATP + EAD EE P P+ ++++ Sbjct: 134 RIQRNILSDKPRVTKFPINFHPENSETGEQATPPGHAGEADGCEEQSQPSPNHLSNEE 191 >XP_011035137.1 PREDICTED: histone chaperone ASF1B-like [Populus euphratica] Length = 193 Score = 74.3 bits (181), Expect = 4e-14 Identities = 37/59 (62%), Positives = 44/59 (74%), Gaps = 3/59 (5%) Frame = +1 Query: 1 KVQRNILTDKPRVTKFPINFHPENNESGEQATPVDNPAEADVIEEPPPSS---TADKDG 168 KVQRNIL+DKPRVTKFPINF+PEN E E+ D PAE D EE PP+S ++DK+G Sbjct: 134 KVQRNILSDKPRVTKFPINFYPENTEGAEEPLVNDQPAETDGNEERPPASPHHSSDKEG 192 >OIW14707.1 hypothetical protein TanjilG_33049 [Lupinus angustifolius] Length = 188 Score = 73.6 bits (179), Expect = 8e-14 Identities = 36/54 (66%), Positives = 41/54 (75%), Gaps = 6/54 (11%) Frame = +1 Query: 1 KVQRNILTDKPRVTKFPINFHPENNESGEQATPVDNPAE------ADVIEEPPP 144 +VQRNIL+DKPRVTKFPINFHPEN E+ +QA P DNPAE A V +PPP Sbjct: 131 RVQRNILSDKPRVTKFPINFHPENTENDDQAPPPDNPAETGEDLLAAVDADPPP 184 >XP_019438250.1 PREDICTED: histone chaperone ASF1B-like [Lupinus angustifolius] Length = 191 Score = 73.6 bits (179), Expect = 8e-14 Identities = 36/54 (66%), Positives = 41/54 (75%), Gaps = 6/54 (11%) Frame = +1 Query: 1 KVQRNILTDKPRVTKFPINFHPENNESGEQATPVDNPAE------ADVIEEPPP 144 +VQRNIL+DKPRVTKFPINFHPEN E+ +QA P DNPAE A V +PPP Sbjct: 134 RVQRNILSDKPRVTKFPINFHPENTENDDQAPPPDNPAETGEDLLAAVDADPPP 187 >XP_004238871.1 PREDICTED: probable histone chaperone ASF1A [Solanum lycopersicum] Length = 193 Score = 73.6 bits (179), Expect = 9e-14 Identities = 35/50 (70%), Positives = 38/50 (76%) Frame = +1 Query: 1 KVQRNILTDKPRVTKFPINFHPENNESGEQATPVDNPAEADVIEEPPPSS 150 ++QRNIL DKPRVTKFPINFHPENNE GEQA P DN E + E P SS Sbjct: 134 RIQRNILVDKPRVTKFPINFHPENNEDGEQAPP-DNATEEKALREEPVSS 182 >GAV87474.1 ASF1_hist_chap domain-containing protein, partial [Cephalotus follicularis] Length = 209 Score = 73.2 bits (178), Expect = 2e-13 Identities = 35/49 (71%), Positives = 39/49 (79%) Frame = +1 Query: 1 KVQRNILTDKPRVTKFPINFHPENNESGEQATPVDNPAEADVIEEPPPS 147 KVQRNIL+DKPRVTKFPINFHPEN ESGE+ D+PAE + EE P S Sbjct: 151 KVQRNILSDKPRVTKFPINFHPENGESGEEPPQPDHPAEMNGDEEQPVS 199 >XP_015074951.1 PREDICTED: probable histone chaperone ASF1A [Solanum pennellii] Length = 193 Score = 72.8 bits (177), Expect = 2e-13 Identities = 35/50 (70%), Positives = 38/50 (76%) Frame = +1 Query: 1 KVQRNILTDKPRVTKFPINFHPENNESGEQATPVDNPAEADVIEEPPPSS 150 ++QRNIL DKPRVTKFPINFHPENNE GEQ P DN E V+ E P SS Sbjct: 134 RIQRNILVDKPRVTKFPINFHPENNEDGEQGPP-DNATEEKVLGEEPVSS 182 >XP_018816794.1 PREDICTED: probable histone chaperone ASF1A [Juglans regia] XP_018816796.1 PREDICTED: probable histone chaperone ASF1A [Juglans regia] Length = 193 Score = 72.4 bits (176), Expect = 2e-13 Identities = 34/49 (69%), Positives = 40/49 (81%) Frame = +1 Query: 1 KVQRNILTDKPRVTKFPINFHPENNESGEQATPVDNPAEADVIEEPPPS 147 +VQRNIL+DKPRVTKFPINFHPE++ES EQ P D+P+E D EE P S Sbjct: 134 RVQRNILSDKPRVTKFPINFHPEDSESREQPQPPDHPSETDGNEELPAS 182 >XP_002528058.1 PREDICTED: probable histone chaperone ASF1A [Ricinus communis] EEF34308.1 anti-silencing protein, putative [Ricinus communis] Length = 193 Score = 72.4 bits (176), Expect = 2e-13 Identities = 35/59 (59%), Positives = 41/59 (69%), Gaps = 3/59 (5%) Frame = +1 Query: 1 KVQRNILTDKPRVTKFPINFHPENNESGEQATPVDNPAEADVIEE---PPPSSTADKDG 168 K+QRNIL+DKPRVTKFPINF PEN E E+ TP D P E D E+ P P + DK+G Sbjct: 134 KIQRNILSDKPRVTKFPINFCPENAEGAEEPTPQDQPPETDENEDQLPPSPEHSTDKEG 192 >XP_015065132.1 PREDICTED: probable histone chaperone ASF1A [Solanum pennellii] Length = 181 Score = 72.0 bits (175), Expect = 3e-13 Identities = 36/47 (76%), Positives = 39/47 (82%), Gaps = 3/47 (6%) Frame = +1 Query: 4 VQRNILTDKPRVTKFPINFHPENNESGEQAT---PVDNPAEADVIEE 135 +QRNILTDKPRVTKFPINFHPEN+E+GEQA P DN AEAD EE Sbjct: 135 LQRNILTDKPRVTKFPINFHPENSETGEQAAAPPPDDNTAEADGYEE 181