BLASTX nr result
ID: Panax24_contig00017669
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00017669 (591 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017233913.1 PREDICTED: uncharacterized protein LOC108207961 [... 55 1e-06 >XP_017233913.1 PREDICTED: uncharacterized protein LOC108207961 [Daucus carota subsp. sativus] KZN07158.1 hypothetical protein DCAR_007995 [Daucus carota subsp. sativus] Length = 114 Score = 55.1 bits (131), Expect = 1e-06 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 1/40 (2%) Frame = +3 Query: 474 FTHANVLAVENSTVVEMVPLIEPGK-AEMVVMQNDSRRRL 590 F AN L +EN T+VEMVPLIEPGK EM++M NDSRRRL Sbjct: 21 FAQANGLVMENGTMVEMVPLIEPGKTGEMMMMMNDSRRRL 60