BLASTX nr result
ID: Panax24_contig00017611
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00017611 (506 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN11542.1 hypothetical protein DCAR_004198 [Daucus carota subsp... 64 8e-09 XP_017229926.1 PREDICTED: thiamine thiazole synthase 2, chloropl... 64 8e-09 KZM84417.1 hypothetical protein DCAR_028161 [Daucus carota subsp... 63 2e-08 XP_017222953.1 PREDICTED: thiamine thiazole synthase 2, chloropl... 63 2e-08 >KZN11542.1 hypothetical protein DCAR_004198 [Daucus carota subsp. sativus] Length = 343 Score = 63.5 bits (153), Expect = 8e-09 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -2 Query: 505 GQKAAHLALRALGLPNALIETQPEFVIADAPADEIVDA 392 GQKAAHLALRALGLPNAL E+QPEFVIADA ADEIV+A Sbjct: 307 GQKAAHLALRALGLPNALEESQPEFVIADA-ADEIVEA 343 >XP_017229926.1 PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Daucus carota subsp. sativus] Length = 346 Score = 63.5 bits (153), Expect = 8e-09 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -2 Query: 505 GQKAAHLALRALGLPNALIETQPEFVIADAPADEIVDA 392 GQKAAHLALRALGLPNAL E+QPEFVIADA ADEIV+A Sbjct: 310 GQKAAHLALRALGLPNALEESQPEFVIADA-ADEIVEA 346 >KZM84417.1 hypothetical protein DCAR_028161 [Daucus carota subsp. sativus] Length = 346 Score = 62.8 bits (151), Expect = 2e-08 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -2 Query: 505 GQKAAHLALRALGLPNALIETQPEFVIADAPADEIVDA 392 GQKAAHLALRALGLPNAL E QPEFVIADA A++IVDA Sbjct: 310 GQKAAHLALRALGLPNALTEAQPEFVIADA-AEDIVDA 346 >XP_017222953.1 PREDICTED: thiamine thiazole synthase 2, chloroplastic-like isoform X1 [Daucus carota subsp. sativus] Length = 349 Score = 62.8 bits (151), Expect = 2e-08 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -2 Query: 505 GQKAAHLALRALGLPNALIETQPEFVIADAPADEIVDA 392 GQKAAHLALRALGLPNAL E QPEFVIADA A++IVDA Sbjct: 313 GQKAAHLALRALGLPNALTEAQPEFVIADA-AEDIVDA 349