BLASTX nr result
ID: Panax24_contig00017607
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00017607 (453 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017702195.1 PREDICTED: zinc finger BED domain-containing prot... 82 3e-17 XP_017250711.1 PREDICTED: zinc finger BED domain-containing prot... 83 9e-16 XP_008780286.1 PREDICTED: zinc finger BED domain-containing prot... 79 3e-15 XP_008779896.1 PREDICTED: zinc finger BED domain-containing prot... 77 8e-15 XP_008779743.1 PREDICTED: zinc finger BED domain-containing prot... 75 6e-13 XP_015950046.1 PREDICTED: zinc finger BED domain-containing prot... 75 8e-13 XP_019158383.1 PREDICTED: zinc finger BED domain-containing prot... 70 9e-13 XP_011093469.1 PREDICTED: zinc finger BED domain-containing prot... 71 1e-12 XP_015962322.1 PREDICTED: zinc finger BED domain-containing prot... 73 2e-12 XP_016166020.1 PREDICTED: zinc finger BED domain-containing prot... 74 2e-12 XP_019158453.1 PREDICTED: zinc finger BED domain-containing prot... 70 2e-12 XP_019167159.1 PREDICTED: zinc finger BED domain-containing prot... 70 3e-12 KMT03829.1 hypothetical protein BVRB_8g189720 [Beta vulgaris sub... 72 5e-12 GAU36100.1 hypothetical protein TSUD_277110 [Trifolium subterran... 72 7e-12 XP_012575095.1 PREDICTED: zinc finger BED domain-containing prot... 72 7e-12 XP_012568925.1 PREDICTED: zinc finger BED domain-containing prot... 72 7e-12 KZV35483.1 zinc finger BED domain-containing protein RICESLEEPER... 68 7e-12 XP_015964988.1 PREDICTED: zinc finger BED domain-containing prot... 72 8e-12 XP_019163645.1 PREDICTED: zinc finger BED domain-containing prot... 70 9e-12 XP_019157996.1 PREDICTED: zinc finger BED domain-containing prot... 70 9e-12 >XP_017702195.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Phoenix dactylifera] Length = 131 Score = 82.0 bits (201), Expect = 3e-17 Identities = 38/54 (70%), Positives = 46/54 (85%) Frame = -3 Query: 430 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALICTGDWLRAEYKIKKSMIADED 269 +TTVASE+ FSAGGRV DQ+RSSLKP+TVQALICTGDWLR E +++S DE+ Sbjct: 64 ITTVASEAAFSAGGRVLDQYRSSLKPETVQALICTGDWLRQELGLEQSSNVDEE 117 >XP_017250711.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Daucus carota subsp. sativus] Length = 710 Score = 83.2 bits (204), Expect = 9e-16 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = -3 Query: 430 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALICTGDWLRAEYKI 296 +TTVASESTFSAGGRV DQ+RSSLKP+TV+ALICT DWLRA+YKI Sbjct: 638 ITTVASESTFSAGGRVLDQYRSSLKPETVEALICTSDWLRADYKI 682 >XP_008780286.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Phoenix dactylifera] Length = 195 Score = 78.6 bits (192), Expect = 3e-15 Identities = 36/54 (66%), Positives = 45/54 (83%) Frame = -3 Query: 430 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALICTGDWLRAEYKIKKSMIADED 269 +TTVASE+ FSAGGRV DQ+RSSLKP+TV+ALICTGDWL E +++S DE+ Sbjct: 131 ITTVASEAAFSAGGRVLDQYRSSLKPETVEALICTGDWLHHELGLEQSSNVDEE 184 >XP_008779896.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Phoenix dactylifera] Length = 195 Score = 77.4 bits (189), Expect = 8e-15 Identities = 36/54 (66%), Positives = 45/54 (83%) Frame = -3 Query: 430 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALICTGDWLRAEYKIKKSMIADED 269 +TTVASE+ FSAGGRV DQ+ SSLKP+TV+ALICTGDWLR E +++S DE+ Sbjct: 131 ITTVASEAAFSAGGRVLDQYCSSLKPETVEALICTGDWLRHELGLEQSSNVDEE 184 >XP_008779743.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Phoenix dactylifera] Length = 663 Score = 75.1 bits (183), Expect = 6e-13 Identities = 36/54 (66%), Positives = 43/54 (79%) Frame = -3 Query: 430 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALICTGDWLRAEYKIKKSMIADED 269 +TTVASE+ FSAGGRV DQ+RSSLKP TVQALICT DWL E +++S DE+ Sbjct: 599 ITTVASEAAFSAGGRVLDQYRSSLKPATVQALICTRDWLHHELGLEQSSNVDEE 652 >XP_015950046.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Arachis duranensis] Length = 561 Score = 74.7 bits (182), Expect = 8e-13 Identities = 37/57 (64%), Positives = 44/57 (77%), Gaps = 1/57 (1%) Frame = -3 Query: 430 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALICTGDWLRAEYKIK-KSMIADEDLE 263 ++TVASESTFSAGGRV D FRSSL P TV+ALIC GDWLR Y ++ KS + D +E Sbjct: 500 ISTVASESTFSAGGRVIDTFRSSLSPTTVEALICGGDWLRVFYGLRNKSKVEDSSVE 556 >XP_019158383.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Ipomoea nil] Length = 131 Score = 70.5 bits (171), Expect = 9e-13 Identities = 32/60 (53%), Positives = 45/60 (75%) Frame = -3 Query: 430 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALICTGDWLRAEYKIKKSMIADEDLETEVL 251 +++VASESTFSAGGRV D++R+SL ++++ALIC GDWLR +Y +KK D E +L Sbjct: 70 ISSVASESTFSAGGRVIDEYRASLNEESIEALICGGDWLRNKYGLKKKQKGDSGQEEIML 129 >XP_011093469.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 1-like isoform X2 [Sesamum indicum] Length = 170 Score = 71.2 bits (173), Expect = 1e-12 Identities = 31/53 (58%), Positives = 42/53 (79%) Frame = -3 Query: 430 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALICTGDWLRAEYKIKKSMIADE 272 +TTVASE+TFSAG RV D++R+SL DTVQ L+C GDWLR + +KK ++D+ Sbjct: 102 ITTVASEATFSAGSRVIDKYRASLTSDTVQVLMCGGDWLRKRFGVKKKSLSDK 154 >XP_015962322.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Arachis duranensis] Length = 314 Score = 73.2 bits (178), Expect = 2e-12 Identities = 36/57 (63%), Positives = 43/57 (75%), Gaps = 1/57 (1%) Frame = -3 Query: 430 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALICTGDWLRAEYKIK-KSMIADEDLE 263 ++TV SESTFSAGGRV D FRSSL P TV+ALIC GDWLR Y ++ KS + D +E Sbjct: 253 ISTVVSESTFSAGGRVIDTFRSSLSPTTVEALICGGDWLRVFYGLRNKSKVEDSSVE 309 >XP_016166020.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Arachis ipaensis] Length = 724 Score = 73.9 bits (180), Expect = 2e-12 Identities = 37/57 (64%), Positives = 43/57 (75%), Gaps = 1/57 (1%) Frame = -3 Query: 430 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALICTGDWLRAEYKIK-KSMIADEDLE 263 + TVASESTFSAGGRV D FRSSL P TV+ALIC GDWLR Y ++ KS + D +E Sbjct: 663 ILTVASESTFSAGGRVIDTFRSSLSPTTVEALICGGDWLRVFYGLRNKSKVEDSSVE 719 >XP_019158453.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Ipomoea nil] Length = 131 Score = 69.7 bits (169), Expect = 2e-12 Identities = 31/62 (50%), Positives = 48/62 (77%) Frame = -3 Query: 430 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALICTGDWLRAEYKIKKSMIADEDLETEVL 251 +++VASESTFSAGGRV D++R+SL ++++ALIC GDWLR +Y +KK D + E++ Sbjct: 70 ISSVASESTFSAGGRVIDEYRASLNEESIEALICGGDWLRNKYGLKKKQKGDSG-QQEIM 128 Query: 250 MQ 245 ++ Sbjct: 129 LK 130 >XP_019167159.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Ipomoea nil] Length = 156 Score = 69.7 bits (169), Expect = 3e-12 Identities = 32/60 (53%), Positives = 45/60 (75%) Frame = -3 Query: 430 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALICTGDWLRAEYKIKKSMIADEDLETEVL 251 +++VASESTFSAGGRV D++R+SL ++++ALIC GDWLR +Y +KK D E +L Sbjct: 95 ISSVASESTFSAGGRVTDEYRASLNEESIEALICGGDWLRNKYGLKKKQKGDSGQEEIML 154 >KMT03829.1 hypothetical protein BVRB_8g189720 [Beta vulgaris subsp. vulgaris] Length = 648 Score = 72.4 bits (176), Expect = 5e-12 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 1/62 (1%) Frame = -3 Query: 430 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALICTGDWLRAEYKIK-KSMIADEDLETEV 254 +TTVASE+TFSAG RV D +RSSL P+TVQ LICTGDW R+ + IK K+ DE E+ Sbjct: 584 ITTVASEATFSAGSRVIDPYRSSLLPETVQMLICTGDWCRSTFGIKRKNKFVDEYEPKEI 643 Query: 253 LM 248 ++ Sbjct: 644 II 645 >GAU36100.1 hypothetical protein TSUD_277110 [Trifolium subterraneum] Length = 521 Score = 72.0 bits (175), Expect = 7e-12 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 1/62 (1%) Frame = -3 Query: 430 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALICTGDWLRAEYKIK-KSMIADEDLETEV 254 ++TVASESTFSAGGRV D FR+SL P TV++LIC GDWLR + IK K + +E E+ Sbjct: 460 ISTVASESTFSAGGRVIDSFRASLDPSTVESLICGGDWLRVLHGIKNKPKVKQVPIEIEL 519 Query: 253 LM 248 L+ Sbjct: 520 LL 521 >XP_012575095.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Cicer arietinum] Length = 351 Score = 71.6 bits (174), Expect = 7e-12 Identities = 32/53 (60%), Positives = 41/53 (77%) Frame = -3 Query: 430 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALICTGDWLRAEYKIKKSMIADE 272 ++TVASESTFSAGGRV D+FRS L ++V+ALIC GDW R +Y +KK D+ Sbjct: 290 ISTVASESTFSAGGRVIDEFRSKLNEESVEALICGGDWFRHKYNVKKKSKVDK 342 >XP_012568925.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Cicer arietinum] Length = 352 Score = 71.6 bits (174), Expect = 7e-12 Identities = 32/53 (60%), Positives = 41/53 (77%) Frame = -3 Query: 430 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALICTGDWLRAEYKIKKSMIADE 272 ++TVASESTFSAGGRV D+FRS L ++V+ALIC GDW R +Y +KK D+ Sbjct: 291 ISTVASESTFSAGGRVIDEFRSKLNEESVEALICGGDWFRHKYNVKKKSKVDK 343 >KZV35483.1 zinc finger BED domain-containing protein RICESLEEPER 2-like [Dorcoceras hygrometricum] Length = 116 Score = 67.8 bits (164), Expect = 7e-12 Identities = 30/53 (56%), Positives = 40/53 (75%) Frame = -3 Query: 430 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALICTGDWLRAEYKIKKSMIADE 272 +TTVASE+TFSAG RV D++R+SL P TV+ L+C GDW R Y +KK A++ Sbjct: 54 ITTVASEATFSAGSRVIDKYRASLAPSTVEMLMCGGDWCRKRYGVKKKTKAEK 106 >XP_015964988.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Arachis duranensis] Length = 400 Score = 71.6 bits (174), Expect = 8e-12 Identities = 35/57 (61%), Positives = 42/57 (73%), Gaps = 1/57 (1%) Frame = -3 Query: 430 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALICTGDWLRAEYKIK-KSMIADEDLE 263 ++TVASESTFSAGGRV D FRSSL P T + LIC GDWLR Y ++ KS + D +E Sbjct: 339 ISTVASESTFSAGGRVIDTFRSSLSPTTAETLICGGDWLRVFYGLRNKSKVEDSSVE 395 >XP_019163645.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Ipomoea nil] Length = 209 Score = 69.7 bits (169), Expect = 9e-12 Identities = 31/62 (50%), Positives = 48/62 (77%) Frame = -3 Query: 430 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALICTGDWLRAEYKIKKSMIADEDLETEVL 251 +++VASESTFSAGGRV D++R+SL ++++ALIC GDWLR +Y +KK D + E++ Sbjct: 148 ISSVASESTFSAGGRVIDEYRASLNEESIEALICGGDWLRNKYGLKKKQKGDSG-QQEIM 206 Query: 250 MQ 245 ++ Sbjct: 207 LK 208 >XP_019157996.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Ipomoea nil] Length = 209 Score = 69.7 bits (169), Expect = 9e-12 Identities = 31/62 (50%), Positives = 48/62 (77%) Frame = -3 Query: 430 VTTVASESTFSAGGRVFDQFRSSLKPDTVQALICTGDWLRAEYKIKKSMIADEDLETEVL 251 +++VASESTFSAGGRV D++R+SL ++++ALIC GDWLR +Y +KK D + E++ Sbjct: 148 ISSVASESTFSAGGRVIDEYRASLNEESIEALICGGDWLRNKYGLKKKQKGDSG-QQEIM 206 Query: 250 MQ 245 ++ Sbjct: 207 LK 208