BLASTX nr result
ID: Panax24_contig00017569
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00017569 (610 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EYU24693.1 hypothetical protein MIMGU_mgv1a018247mg [Erythranthe... 72 3e-13 OAY53734.1 hypothetical protein MANES_03G019500 [Manihot esculenta] 70 2e-12 OIS96554.1 hypothetical protein A4A49_08814 [Nicotiana attenuata] 68 9e-12 XP_009786429.1 PREDICTED: uncharacterized protein LOC104234552 [... 67 2e-11 KJB06145.1 hypothetical protein B456_001G004700 [Gossypium raimo... 66 3e-11 XP_006451138.1 hypothetical protein CICLE_v10010038mg [Citrus cl... 66 8e-11 OMO90070.1 hypothetical protein CCACVL1_07524 [Corchorus capsula... 65 8e-11 OMO58020.1 hypothetical protein COLO4_34908 [Corchorus olitorius] 65 1e-10 EEF48276.1 conserved hypothetical protein [Ricinus communis] 65 1e-10 CDY02542.1 BnaA08g01490D [Brassica napus] 65 1e-10 XP_013724791.1 PREDICTED: uncharacterized protein LOC106428587 [... 65 1e-10 XP_013590689.1 PREDICTED: uncharacterized protein LOC106299096 [... 64 3e-10 KDP33658.1 hypothetical protein JCGZ_07229 [Jatropha curcas] 64 4e-10 XP_013721379.1 PREDICTED: uncharacterized protein LOC106425203 [... 64 4e-10 EOY30820.1 Uncharacterized protein TCM_037899 [Theobroma cacao] 64 5e-10 KHN20688.1 hypothetical protein glysoja_019005 [Glycine soja] KR... 63 5e-10 JAU77534.1 hypothetical protein MP_TR20413_c0_g1_i1_g.58234 [Noc... 62 1e-09 XP_009107136.1 PREDICTED: uncharacterized protein LOC103832796 [... 62 2e-09 XP_013626551.1 PREDICTED: uncharacterized protein LOC106332614 [... 62 2e-09 XP_015077854.1 PREDICTED: uncharacterized protein LOC107021669 [... 62 2e-09 >EYU24693.1 hypothetical protein MIMGU_mgv1a018247mg [Erythranthe guttata] Length = 88 Score = 72.0 bits (175), Expect = 3e-13 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = -2 Query: 591 GGGEMKQCVCSPTRHPGSFRCRYHHTEYKWVGRLGPKPN 475 GGG K CVCSPT HPGSFRCR+HH EY+WV RLG KP+ Sbjct: 50 GGGMTKVCVCSPTGHPGSFRCRHHHGEYQWVNRLGTKPS 88 >OAY53734.1 hypothetical protein MANES_03G019500 [Manihot esculenta] Length = 80 Score = 69.7 bits (169), Expect = 2e-12 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -2 Query: 594 DGGGEMKQCVCSPTRHPGSFRCRYHHTEYKWVGRLGPK 481 DGGG MK+CVCSPTRHPGSFRCR+HH +Y+W R+ K Sbjct: 43 DGGGSMKKCVCSPTRHPGSFRCRHHHGDYEWGRRITKK 80 >OIS96554.1 hypothetical protein A4A49_08814 [Nicotiana attenuata] Length = 89 Score = 68.2 bits (165), Expect = 9e-12 Identities = 29/40 (72%), Positives = 32/40 (80%), Gaps = 1/40 (2%) Frame = -2 Query: 591 GGGEMK-QCVCSPTRHPGSFRCRYHHTEYKWVGRLGPKPN 475 G G K QCVCSPT+HPGSFRCR+HH+EYKWV L KPN Sbjct: 40 GAGMKKFQCVCSPTKHPGSFRCRHHHSEYKWVAPLRTKPN 79 >XP_009786429.1 PREDICTED: uncharacterized protein LOC104234552 [Nicotiana sylvestris] Length = 89 Score = 67.4 bits (163), Expect = 2e-11 Identities = 28/40 (70%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = -2 Query: 591 GGGEMK-QCVCSPTRHPGSFRCRYHHTEYKWVGRLGPKPN 475 G G K QCVCSPT+HPGSFRCR+HH++YKWV LG KP+ Sbjct: 39 GAGMRKFQCVCSPTKHPGSFRCRHHHSDYKWVAPLGIKPS 78 >KJB06145.1 hypothetical protein B456_001G004700 [Gossypium raimondii] Length = 73 Score = 66.2 bits (160), Expect = 3e-11 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -2 Query: 603 RVEDGGGEMKQCVCSPTRHPGSFRCRYHHTEYKWVGR 493 R +G G MKQC+CSPT+HPGSFRCR+HH EY W GR Sbjct: 32 RDTNGVGSMKQCLCSPTKHPGSFRCRHHHAEYVWGGR 68 >XP_006451138.1 hypothetical protein CICLE_v10010038mg [Citrus clementina] ESR64378.1 hypothetical protein CICLE_v10010038mg [Citrus clementina] Length = 91 Score = 65.9 bits (159), Expect = 8e-11 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -2 Query: 591 GGGEMKQCVCSPTRHPGSFRCRYHHTEYKWVGRL 490 GGG +KQCVCSPT HPGSFRCR+HH +Y W GR+ Sbjct: 48 GGGLIKQCVCSPTTHPGSFRCRHHHAQYVWRGRI 81 >OMO90070.1 hypothetical protein CCACVL1_07524 [Corchorus capsularis] Length = 68 Score = 65.1 bits (157), Expect = 8e-11 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -2 Query: 591 GGGEMKQCVCSPTRHPGSFRCRYHHTEYKWVGR 493 GGG MKQC+CSPT+HPGSFRCR+H EY W GR Sbjct: 31 GGGSMKQCLCSPTKHPGSFRCRHHQGEYVWGGR 63 >OMO58020.1 hypothetical protein COLO4_34908 [Corchorus olitorius] Length = 76 Score = 65.1 bits (157), Expect = 1e-10 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -2 Query: 591 GGGEMKQCVCSPTRHPGSFRCRYHHTEYKWVGR 493 GGG MKQC+CSPT+HPGSFRCR+H EY W GR Sbjct: 39 GGGSMKQCLCSPTKHPGSFRCRHHQGEYVWGGR 71 >EEF48276.1 conserved hypothetical protein [Ricinus communis] Length = 90 Score = 65.5 bits (158), Expect = 1e-10 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -2 Query: 591 GGGEMKQCVCSPTRHPGSFRCRYHHTEYKWVGRLGPK 481 GGG +K CVCSPTRHPGSFRCR+HH +Y W R+ K Sbjct: 54 GGGSIKMCVCSPTRHPGSFRCRHHHVDYAWGRRITKK 90 >CDY02542.1 BnaA08g01490D [Brassica napus] Length = 78 Score = 65.1 bits (157), Expect = 1e-10 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -2 Query: 603 RVEDGGGEMKQCVCSPTRHPGSFRCRYHHTEYKWV 499 R DGGGE K+CVCSP+ HP SF+CRYHH EY+WV Sbjct: 37 RHRDGGGEKKKCVCSPSTHPRSFKCRYHHHEYQWV 71 >XP_013724791.1 PREDICTED: uncharacterized protein LOC106428587 [Brassica napus] CDY47534.1 BnaC03g69280D [Brassica napus] Length = 79 Score = 65.1 bits (157), Expect = 1e-10 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -2 Query: 603 RVEDGGGEMKQCVCSPTRHPGSFRCRYHHTEYKWV 499 R DGGGE K+CVCSP+ HP SF+CRYHH EY+WV Sbjct: 37 RHRDGGGEKKKCVCSPSTHPRSFKCRYHHHEYQWV 71 >XP_013590689.1 PREDICTED: uncharacterized protein LOC106299096 [Brassica oleracea var. oleracea] CDX87902.1 BnaC06g09640D [Brassica napus] Length = 81 Score = 63.9 bits (154), Expect = 3e-10 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = -2 Query: 600 VEDGGGEMKQCVCSPTRHPGSFRCRYHHTEYKWVGRLGPKPN*AAS 463 V D GGE K CVCSP++HP SF+CRYHH EY+W+ P+ ++S Sbjct: 33 VRDAGGEKKVCVCSPSKHPRSFKCRYHHHEYQWLPSSSSSPSSSSS 78 >KDP33658.1 hypothetical protein JCGZ_07229 [Jatropha curcas] Length = 86 Score = 63.9 bits (154), Expect = 4e-10 Identities = 24/37 (64%), Positives = 29/37 (78%) Frame = -2 Query: 591 GGGEMKQCVCSPTRHPGSFRCRYHHTEYKWVGRLGPK 481 GGG +K C+CSPTRH GSFRCRYHH +Y+W R+ K Sbjct: 50 GGGSIKSCICSPTRHAGSFRCRYHHGDYEWGRRITKK 86 >XP_013721379.1 PREDICTED: uncharacterized protein LOC106425203 [Brassica napus] Length = 81 Score = 63.5 bits (153), Expect = 4e-10 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = -2 Query: 600 VEDGGGEMKQCVCSPTRHPGSFRCRYHHTEYKWVGRLGPKPN*AAS 463 V D GGE K CVCSP++HP SF+CRYHH EY+W+ P+ ++S Sbjct: 33 VRDDGGEKKVCVCSPSKHPRSFKCRYHHHEYQWLPSSSSSPSSSSS 78 >EOY30820.1 Uncharacterized protein TCM_037899 [Theobroma cacao] Length = 84 Score = 63.5 bits (153), Expect = 5e-10 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -2 Query: 591 GGGEMKQCVCSPTRHPGSFRCRYHHTEYKWVGR 493 G MKQC+CSPT+HPGSFRCR+HH EY W GR Sbjct: 47 GSTSMKQCLCSPTKHPGSFRCRHHHAEYVWGGR 79 >KHN20688.1 hypothetical protein glysoja_019005 [Glycine soja] KRH48407.1 hypothetical protein GLYMA_07G087100 [Glycine max] Length = 76 Score = 63.2 bits (152), Expect = 5e-10 Identities = 26/42 (61%), Positives = 31/42 (73%), Gaps = 5/42 (11%) Frame = -2 Query: 603 RVEDGGGE-----MKQCVCSPTRHPGSFRCRYHHTEYKWVGR 493 +V DGGG +K CVCSP++HPGSFRCR HH EY W+GR Sbjct: 32 QVHDGGGSGESGSVKHCVCSPSQHPGSFRCRLHHGEYVWIGR 73 >JAU77534.1 hypothetical protein MP_TR20413_c0_g1_i1_g.58234 [Noccaea caerulescens] Length = 83 Score = 62.4 bits (150), Expect = 1e-09 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = -2 Query: 594 DGGGEMKQCVCSPTRHPGSFRCRYHHTEYKWVGRLGP 484 DGGG K+CVCSP++HP SF+CRYHH EY+W+ P Sbjct: 40 DGGGGKKKCVCSPSKHPRSFKCRYHHHEYQWLPSSSP 76 >XP_009107136.1 PREDICTED: uncharacterized protein LOC103832796 [Brassica rapa] Length = 78 Score = 62.0 bits (149), Expect = 2e-09 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = -2 Query: 603 RVEDGGGEMKQCVCSPTRHPGSFRCRYHHTEYKWV 499 R DG GE K+CVCSP+ HP SF+CRYHH EY+WV Sbjct: 37 RHRDGRGEKKKCVCSPSTHPRSFKCRYHHHEYQWV 71 >XP_013626551.1 PREDICTED: uncharacterized protein LOC106332614 [Brassica oleracea var. oleracea] Length = 79 Score = 62.0 bits (149), Expect = 2e-09 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = -2 Query: 603 RVEDGGGEMKQCVCSPTRHPGSFRCRYHHTEYKWV 499 R DG GE K+CVCSP+ HP SF+CRYHH EY+WV Sbjct: 37 RHRDGRGEKKKCVCSPSTHPRSFKCRYHHHEYQWV 71 >XP_015077854.1 PREDICTED: uncharacterized protein LOC107021669 [Solanum pennellii] Length = 82 Score = 62.0 bits (149), Expect = 2e-09 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = -2 Query: 585 GEMKQCVCSPTRHPGSFRCRYHHTEYKWVGRLG 487 G MKQCVCSPT HPGSFRCR+H+ +YKW + G Sbjct: 43 GMMKQCVCSPTHHPGSFRCRHHYADYKWAAQQG 75