BLASTX nr result
ID: Panax24_contig00017366
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00017366 (663 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012842365.1 PREDICTED: uncharacterized protein LOC105962598 [... 58 3e-07 XP_012836240.1 PREDICTED: uncharacterized protein LOC105956877 [... 56 1e-06 >XP_012842365.1 PREDICTED: uncharacterized protein LOC105962598 [Erythranthe guttata] Length = 141 Score = 57.8 bits (138), Expect = 3e-07 Identities = 26/53 (49%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = +3 Query: 294 CKCGVPSPVKVSWTKTNLKTNLGRRFVGCTNY-KTIPCNSFEWIDPQMSPGSR 449 CKCG+ P+ SWT N GRRF+ C NY K CN FEW+DP+M S+ Sbjct: 33 CKCGIELPINTSWT----DKNPGRRFLACANYMKVSHCNYFEWVDPEMCGRSK 81 >XP_012836240.1 PREDICTED: uncharacterized protein LOC105956877 [Erythranthe guttata] Length = 141 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/53 (47%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = +3 Query: 294 CKCGVPSPVKVSWTKTNLKTNLGRRFVGCTNY-KTIPCNSFEWIDPQMSPGSR 449 CKCG+ P+ SWT N GRRF+ C NY K CN FEW++P+M S+ Sbjct: 33 CKCGIELPINTSWT----DKNPGRRFLACANYMKVSHCNYFEWVEPEMCGRSK 81