BLASTX nr result
ID: Panax24_contig00016987
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00016987 (716 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN00572.1 hypothetical protein DCAR_009326 [Daucus carota subsp... 57 7e-06 >KZN00572.1 hypothetical protein DCAR_009326 [Daucus carota subsp. sativus] Length = 545 Score = 57.0 bits (136), Expect = 7e-06 Identities = 30/45 (66%), Positives = 33/45 (73%), Gaps = 2/45 (4%) Frame = -3 Query: 129 VRTYALFLEERLECFRVLKHDVETDWPAY--LEIGPLEDS*LVYR 1 VRTYALFLEER+ECFRVLKHDVETD P L I +D +V R Sbjct: 147 VRTYALFLEERMECFRVLKHDVETDRPIQDALSISSADDDLVVQR 191