BLASTX nr result
ID: Panax24_contig00016875
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00016875 (519 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_073461091.1 hypothetical protein [Enterococcus faecium] 52 6e-06 WP_073990056.1 hypothetical protein [Enterococcus faecium] 51 7e-06 WP_073495480.1 hypothetical protein [Enterococcus faecalis] 51 8e-06 WP_073506723.1 hypothetical protein [Enterococcus faecium] 51 9e-06 WP_073990038.1 hypothetical protein [Enterococcus faecium] 52 9e-06 WP_073340585.1 MULTISPECIES: hypothetical protein [Enterococcus] 51 1e-05 >WP_073461091.1 hypothetical protein [Enterococcus faecium] Length = 93 Score = 52.4 bits (124), Expect = 6e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -1 Query: 519 FFNDTATTEIYTLSLHDALPIFHTLSQTL 433 FFNDTATTEIYTLSLHDALPI T+ +TL Sbjct: 17 FFNDTATTEIYTLSLHDALPICSTMDETL 45 >WP_073990056.1 hypothetical protein [Enterococcus faecium] Length = 61 Score = 51.2 bits (121), Expect = 7e-06 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +3 Query: 444 STYERSEERRVGKECRSRWSPYH 512 ST ERSEERRVGKECRSRWSPYH Sbjct: 39 STTERSEERRVGKECRSRWSPYH 61 >WP_073495480.1 hypothetical protein [Enterococcus faecalis] Length = 64 Score = 51.2 bits (121), Expect = 8e-06 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = -1 Query: 519 FFNDTATTEIYTLSLHDALPIFHTL 445 FFNDTATTEIYTLSLHDALPIF+ L Sbjct: 16 FFNDTATTEIYTLSLHDALPIFYVL 40 >WP_073506723.1 hypothetical protein [Enterococcus faecium] Length = 71 Score = 51.2 bits (121), Expect = 9e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +3 Query: 423 LFLSGFDSTYERSEERRVGKECRSRWSPYH 512 LF +GF RSEERRVGKECRSRWSPYH Sbjct: 42 LFQTGFHIKGVRSEERRVGKECRSRWSPYH 71 >WP_073990038.1 hypothetical protein [Enterococcus faecium] Length = 100 Score = 52.0 bits (123), Expect = 9e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -1 Query: 519 FFNDTATTEIYTLSLHDALPIFHTLSQTLKEIIFFI 412 FFNDTATTEIYTLSLHDALPI H+ + +KE++ F+ Sbjct: 24 FFNDTATTEIYTLSLHDALPISHS-PEDVKELLNFM 58 >WP_073340585.1 MULTISPECIES: hypothetical protein [Enterococcus] Length = 59 Score = 50.8 bits (120), Expect = 1e-05 Identities = 22/28 (78%), Positives = 23/28 (82%) Frame = +3 Query: 429 LSGFDSTYERSEERRVGKECRSRWSPYH 512 + G D T RSEERRVGKECRSRWSPYH Sbjct: 32 VDGTDQTSLRSEERRVGKECRSRWSPYH 59