BLASTX nr result
ID: Panax24_contig00016786
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00016786 (401 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017235810.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 1e-08 XP_017235807.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 1e-08 >XP_017235810.1 PREDICTED: pentatricopeptide repeat-containing protein At4g18975, chloroplastic isoform X3 [Daucus carota subsp. sativus] Length = 281 Score = 61.6 bits (148), Expect = 1e-08 Identities = 36/86 (41%), Positives = 51/86 (59%) Frame = -3 Query: 258 MAFVSRNPICFQNVSCGQNQIGFNKVELLLPLRKGRVFFKQMAPRLTVFTTKDTDNSVVK 79 MAF SR C QN + G+ Q+G NKV++L+P RK V K + RL V T + Sbjct: 1 MAFASRISTCLQNSTFGETQLGLNKVKVLVPSRKWSVVCK-LKDRLPVVLTAHS------ 53 Query: 78 CSANQSRKPHRDPNAVEKKMIKKVGK 1 + ++ KP +D N+ +KK+IKKVGK Sbjct: 54 -APTKNIKPSKDSNSAQKKLIKKVGK 78 >XP_017235807.1 PREDICTED: pentatricopeptide repeat-containing protein At4g18975, chloroplastic isoform X1 [Daucus carota subsp. sativus] KZN07083.1 hypothetical protein DCAR_007920 [Daucus carota subsp. sativus] Length = 284 Score = 61.6 bits (148), Expect = 1e-08 Identities = 36/86 (41%), Positives = 51/86 (59%) Frame = -3 Query: 258 MAFVSRNPICFQNVSCGQNQIGFNKVELLLPLRKGRVFFKQMAPRLTVFTTKDTDNSVVK 79 MAF SR C QN + G+ Q+G NKV++L+P RK V K + RL V T + Sbjct: 1 MAFASRISTCLQNSTFGETQLGLNKVKVLVPSRKWSVVCK-LKDRLPVVLTAHS------ 53 Query: 78 CSANQSRKPHRDPNAVEKKMIKKVGK 1 + ++ KP +D N+ +KK+IKKVGK Sbjct: 54 -APTKNIKPSKDSNSAQKKLIKKVGK 78