BLASTX nr result
ID: Panax24_contig00016776
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00016776 (453 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017244786.1 PREDICTED: TPR repeat-containing thioredoxin TTL1... 86 1e-16 KVI07260.1 Tetratricopeptide-like helical [Cynara cardunculus va... 77 9e-14 XP_009758316.1 PREDICTED: TPR repeat-containing thioredoxin TTL2... 75 3e-13 XP_016445441.1 PREDICTED: inactive TPR repeat-containing thiored... 75 6e-13 CDP01039.1 unnamed protein product [Coffea canephora] 75 6e-13 XP_009627310.1 PREDICTED: inactive TPR repeat-containing thiored... 74 2e-12 XP_015060167.1 PREDICTED: small glutamine-rich tetratricopeptide... 72 3e-12 XP_019152335.1 PREDICTED: TPR repeat-containing thioredoxin TTL1... 73 4e-12 XP_016456821.1 PREDICTED: inactive TPR repeat-containing thiored... 72 5e-12 OIT06002.1 inactive tpr repeat-containing thioredoxin ttl3 [Nico... 70 3e-11 XP_019238407.1 PREDICTED: inactive TPR repeat-containing thiored... 70 3e-11 XP_011074174.1 PREDICTED: TPR repeat-containing thioredoxin TTL4... 68 2e-10 XP_019241150.1 PREDICTED: inactive TPR repeat-containing thiored... 64 3e-09 XP_016571551.1 PREDICTED: inactive TPR repeat-containing thiored... 62 3e-08 XP_016476276.1 PREDICTED: inactive TPR repeat-containing thiored... 59 2e-07 XP_010261271.1 PREDICTED: TPR repeat-containing thioredoxin TTL1... 59 4e-07 XP_009759421.1 PREDICTED: inactive TPR repeat-containing thiored... 58 6e-07 XP_011022777.1 PREDICTED: inactive TPR repeat-containing thiored... 58 6e-07 XP_016470146.1 PREDICTED: inactive TPR repeat-containing thiored... 57 8e-07 XP_016470144.1 PREDICTED: inactive TPR repeat-containing thiored... 57 9e-07 >XP_017244786.1 PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Daucus carota subsp. sativus] KZM99907.1 hypothetical protein DCAR_012731 [Daucus carota subsp. sativus] Length = 703 Score = 85.9 bits (211), Expect = 1e-16 Identities = 45/67 (67%), Positives = 52/67 (77%), Gaps = 1/67 (1%) Frame = -2 Query: 215 DRVSHSQVTNVAYTRRLRKEPTFTESELSMRIAVRQKST-SSGVLYRASSGNAMLLGHLG 39 ++ S S + YT+ L+KEPTFTESELSMRIAVRQKST + G+LYRASS N ML HLG Sbjct: 116 NKTSDSSRDQLPYTKWLKKEPTFTESELSMRIAVRQKSTPTGGILYRASSNNGMLPSHLG 175 Query: 38 NLKQPGG 18 NLKQ GG Sbjct: 176 NLKQQGG 182 >KVI07260.1 Tetratricopeptide-like helical [Cynara cardunculus var. scolymus] Length = 583 Score = 77.4 bits (189), Expect = 9e-14 Identities = 45/96 (46%), Positives = 63/96 (65%) Frame = -2 Query: 290 STNQIQGTRPPLNGSTEKSAKILGLDRVSHSQVTNVAYTRRLRKEPTFTESELSMRIAVR 111 +T + + +PP + S KSA S SQVTN++YT++LRKEP+FT SELS+RI+VR Sbjct: 101 ATVRSKPVKPPYD-SISKSALY------SVSQVTNISYTKQLRKEPSFTSSELSLRISVR 153 Query: 110 QKSTSSGVLYRASSGNAMLLGHLGNLKQPGGKNSTT 3 K +G YRASS + M+ GHLGNL + + + T Sbjct: 154 GKPNPNGSTYRASSNHVMVPGHLGNLMKKKPEKTQT 189 >XP_009758316.1 PREDICTED: TPR repeat-containing thioredoxin TTL2-like [Nicotiana sylvestris] Length = 316 Score = 75.1 bits (183), Expect = 3e-13 Identities = 38/82 (46%), Positives = 56/82 (68%) Frame = -2 Query: 248 STEKSAKILGLDRVSHSQVTNVAYTRRLRKEPTFTESELSMRIAVRQKSTSSGVLYRASS 69 S + S+ + R+S QV N+AYT++LR+EPTFT ++LSM I +KS ++G L R+S+ Sbjct: 120 SNKASSNFSSVSRIS--QVVNLAYTQKLRREPTFTSTDLSMTIFSHRKSRTNGTLNRSST 177 Query: 68 GNAMLLGHLGNLKQPGGKNSTT 3 GN L HLGNLK G +N ++ Sbjct: 178 GNVSKLSHLGNLKLQGNQNPSS 199 >XP_016445441.1 PREDICTED: inactive TPR repeat-containing thioredoxin TTL3-like [Nicotiana tabacum] Length = 526 Score = 75.1 bits (183), Expect = 6e-13 Identities = 38/82 (46%), Positives = 56/82 (68%) Frame = -2 Query: 248 STEKSAKILGLDRVSHSQVTNVAYTRRLRKEPTFTESELSMRIAVRQKSTSSGVLYRASS 69 S + S+ + R+S QV N+AYT++LR+EPTFT ++LSM I +KS ++G L R+S+ Sbjct: 120 SNKASSNFSSVSRIS--QVVNLAYTQKLRREPTFTSTDLSMTIFSHRKSRTNGTLNRSST 177 Query: 68 GNAMLLGHLGNLKQPGGKNSTT 3 GN L HLGNLK G +N ++ Sbjct: 178 GNVSKLSHLGNLKLQGNQNPSS 199 >CDP01039.1 unnamed protein product [Coffea canephora] Length = 662 Score = 75.1 bits (183), Expect = 6e-13 Identities = 38/67 (56%), Positives = 46/67 (68%) Frame = -2 Query: 209 VSHSQVTNVAYTRRLRKEPTFTESELSMRIAVRQKSTSSGVLYRASSGNAMLLGHLGNLK 30 +S SQV N YTR LR+EPTFT SE S+ + +S G LYRAS+G+ ML+GHLGNLK Sbjct: 120 ISTSQVVNSEYTRMLRREPTFTSSEFSVTSHRKSNVSSKGHLYRASTGSVMLVGHLGNLK 179 Query: 29 QPGGKNS 9 Q G S Sbjct: 180 QKGHNKS 186 >XP_009627310.1 PREDICTED: inactive TPR repeat-containing thioredoxin TTL3-like [Nicotiana tomentosiformis] Length = 610 Score = 73.6 bits (179), Expect = 2e-12 Identities = 41/90 (45%), Positives = 59/90 (65%) Frame = -2 Query: 272 GTRPPLNGSTEKSAKILGLDRVSHSQVTNVAYTRRLRKEPTFTESELSMRIAVRQKSTSS 93 GTR S + S+ + R+S QV N+AYT++LR+EP+FT ++LSM I +KS ++ Sbjct: 117 GTR----NSNKASSNFSSVTRMS--QVVNLAYTQKLRREPSFTSTDLSMTIFSHRKSRTN 170 Query: 92 GVLYRASSGNAMLLGHLGNLKQPGGKNSTT 3 G L R S+GN LL HLGNLK G +N ++ Sbjct: 171 GTLNRDSTGNVSLLDHLGNLKLQGNQNPSS 200 >XP_015060167.1 PREDICTED: small glutamine-rich tetratricopeptide repeat-containing protein-like [Solanum pennellii] Length = 272 Score = 72.0 bits (175), Expect = 3e-12 Identities = 43/88 (48%), Positives = 57/88 (64%) Frame = -2 Query: 293 SSTNQIQGTRPPLNGSTEKSAKILGLDRVSHSQVTNVAYTRRLRKEPTFTESELSMRIAV 114 S TN ++ +R S K++ +RVS QV N+AYT++LR+EPTFT SELSM I Sbjct: 49 SDTNFVKNSRRCHTSSCPKNSTS-SKNRVS--QVVNLAYTQKLRREPTFTSSELSMTIFS 105 Query: 113 RQKSTSSGVLYRASSGNAMLLGHLGNLK 30 +KS +G L R+S+ N LL HLGNLK Sbjct: 106 HRKSKVNGTLNRSSTSNVTLLSHLGNLK 133 >XP_019152335.1 PREDICTED: TPR repeat-containing thioredoxin TTL1 [Ipomoea nil] XP_019152336.1 PREDICTED: TPR repeat-containing thioredoxin TTL1 [Ipomoea nil] Length = 569 Score = 72.8 bits (177), Expect = 4e-12 Identities = 39/70 (55%), Positives = 48/70 (68%), Gaps = 8/70 (11%) Frame = -2 Query: 200 SQVTNVAYTRRLRKEPTFTESELSMRIAVRQKSTSSGV--------LYRASSGNAMLLGH 45 +QV N+AYT+RLR+EPTFT SELS+ I +KS+++ LYRASSGN ML GH Sbjct: 85 TQVANLAYTQRLRREPTFTSSELSVTIVGHRKSSAAATAAAGSGESLYRASSGNVMLPGH 144 Query: 44 LGNLKQPGGK 15 LGNL Q K Sbjct: 145 LGNLNQKPSK 154 >XP_016456821.1 PREDICTED: inactive TPR repeat-containing thioredoxin TTL3-like [Nicotiana tabacum] Length = 611 Score = 72.4 bits (176), Expect = 5e-12 Identities = 40/90 (44%), Positives = 59/90 (65%) Frame = -2 Query: 272 GTRPPLNGSTEKSAKILGLDRVSHSQVTNVAYTRRLRKEPTFTESELSMRIAVRQKSTSS 93 GTR S + S+ + R++ QV N+AYT++LR+EP+FT ++LSM I +KS ++ Sbjct: 117 GTR----NSNKASSNFSSVTRMT--QVVNLAYTQKLRREPSFTSTDLSMTIFSHRKSRTN 170 Query: 92 GVLYRASSGNAMLLGHLGNLKQPGGKNSTT 3 G L R S+GN LL HLGNLK G +N ++ Sbjct: 171 GTLNRDSTGNVSLLDHLGNLKLQGNQNPSS 200 >OIT06002.1 inactive tpr repeat-containing thioredoxin ttl3 [Nicotiana attenuata] Length = 519 Score = 70.1 bits (170), Expect = 3e-11 Identities = 33/66 (50%), Positives = 48/66 (72%) Frame = -2 Query: 200 SQVTNVAYTRRLRKEPTFTESELSMRIAVRQKSTSSGVLYRASSGNAMLLGHLGNLKQPG 21 SQV N AYT++LR+EP+F+ ++LSM I +KS ++G L R+S+GN L HLGNLK G Sbjct: 119 SQVVNFAYTQKLRREPSFSSADLSMTIFSHRKSRTNGTLNRSSTGNVSKLSHLGNLKLQG 178 Query: 20 GKNSTT 3 +N ++ Sbjct: 179 NQNPSS 184 >XP_019238407.1 PREDICTED: inactive TPR repeat-containing thioredoxin TTL3-like [Nicotiana attenuata] Length = 530 Score = 70.1 bits (170), Expect = 3e-11 Identities = 33/66 (50%), Positives = 48/66 (72%) Frame = -2 Query: 200 SQVTNVAYTRRLRKEPTFTESELSMRIAVRQKSTSSGVLYRASSGNAMLLGHLGNLKQPG 21 SQV N AYT++LR+EP+F+ ++LSM I +KS ++G L R+S+GN L HLGNLK G Sbjct: 130 SQVVNFAYTQKLRREPSFSSADLSMTIFSHRKSRTNGTLNRSSTGNVSKLSHLGNLKLQG 189 Query: 20 GKNSTT 3 +N ++ Sbjct: 190 NQNPSS 195 >XP_011074174.1 PREDICTED: TPR repeat-containing thioredoxin TTL4 [Sesamum indicum] Length = 560 Score = 67.8 bits (164), Expect = 2e-10 Identities = 34/62 (54%), Positives = 46/62 (74%) Frame = -2 Query: 206 SHSQVTNVAYTRRLRKEPTFTESELSMRIAVRQKSTSSGVLYRASSGNAMLLGHLGNLKQ 27 S++ +N TRR +EPTFT SELS+ +A ++K ++ LYRAS+GN MLLGHLG+LKQ Sbjct: 95 SNNSGSNKRLTRRHTQEPTFTSSELSLALADQRKIDANSSLYRASTGNVMLLGHLGSLKQ 154 Query: 26 PG 21 G Sbjct: 155 HG 156 >XP_019241150.1 PREDICTED: inactive TPR repeat-containing thioredoxin TTL3-like [Nicotiana attenuata] OIT19695.1 inactive tpr repeat-containing thioredoxin ttl3 [Nicotiana attenuata] Length = 587 Score = 64.3 bits (155), Expect = 3e-09 Identities = 39/83 (46%), Positives = 56/83 (67%), Gaps = 1/83 (1%) Frame = -2 Query: 248 STEKSAKILGLDRVSHSQVTNVAYTRRLRKEPTFTESELSMRIAVRQKSTSSGVLYRASS 69 ST++S+ +++S QV N A +++LR+EPTFT S +S R KS ++G+L RASS Sbjct: 110 STKQSSNFSSTNKMS--QVVNFANSQKLRREPTFTSSVISHR-----KSNANGILNRASS 162 Query: 68 -GNAMLLGHLGNLKQPGGKNSTT 3 GN MLLG LGNLKQ +N ++ Sbjct: 163 TGNIMLLGQLGNLKQQKNQNGSS 185 >XP_016571551.1 PREDICTED: inactive TPR repeat-containing thioredoxin TTL3-like [Capsicum annuum] Length = 566 Score = 61.6 bits (148), Expect = 3e-08 Identities = 42/84 (50%), Positives = 48/84 (57%), Gaps = 2/84 (2%) Frame = -2 Query: 272 GTRPPLNGSTEKSAKILGLDRVSHSQVTN-VAYTRRLRKEPTFTESELSMRIAVRQKSTS 96 GTR + S K L SQV N V T+ LR++PTFT S+LS I QKS Sbjct: 74 GTRISSKNNNSSSTKKL-------SQVVNLVPNTQNLRRQPTFTSSDLSTTITGHQKSNV 126 Query: 95 SGVLYRASS-GNAMLLGHLGNLKQ 27 +G RASS GN MLLG LGNLKQ Sbjct: 127 NGTFNRASSTGNIMLLGQLGNLKQ 150 >XP_016476276.1 PREDICTED: inactive TPR repeat-containing thioredoxin TTL3-like [Nicotiana tabacum] Length = 587 Score = 58.9 bits (141), Expect = 2e-07 Identities = 37/83 (44%), Positives = 53/83 (63%), Gaps = 1/83 (1%) Frame = -2 Query: 248 STEKSAKILGLDRVSHSQVTNVAYTRRLRKEPTFTESELSMRIAVRQKSTSSGVLYRASS 69 ST++S+ +++S QV N A +++LR EPTFT S +S R KS ++G+L SS Sbjct: 110 STKQSSNFSSTNKMS--QVVNFANSQKLRMEPTFTSSVISHR-----KSNANGILNGVSS 162 Query: 68 -GNAMLLGHLGNLKQPGGKNSTT 3 GN MLLG LGNLKQ +N ++ Sbjct: 163 TGNIMLLGQLGNLKQQKNQNGSS 185 >XP_010261271.1 PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Nelumbo nucifera] Length = 728 Score = 58.5 bits (140), Expect = 4e-07 Identities = 38/98 (38%), Positives = 46/98 (46%), Gaps = 5/98 (5%) Frame = -2 Query: 290 STNQIQGTRPPLNGSTEKSAKILGLDRVSHSQVTNVAYT-----RRLRKEPTFTESELSM 126 S +Q TR P +G T S + S + T R++ KE EL Sbjct: 99 SYHQQNQTRKPSDGITTSSTSSTDSSQTSSTTTTTTTKVSPTQGRKVPKEAIGISGELDS 158 Query: 125 RIAVRQKSTSSGVLYRASSGNAMLLGHLGNLKQPGGKN 12 IA QKS + L RASSGN ML GHLGNL+Q G N Sbjct: 159 MIADHQKSKACNTLVRASSGNVMLYGHLGNLRQKGAGN 196 >XP_009759421.1 PREDICTED: inactive TPR repeat-containing thioredoxin TTL3-like [Nicotiana sylvestris] Length = 587 Score = 57.8 bits (138), Expect = 6e-07 Identities = 36/83 (43%), Positives = 53/83 (63%), Gaps = 1/83 (1%) Frame = -2 Query: 248 STEKSAKILGLDRVSHSQVTNVAYTRRLRKEPTFTESELSMRIAVRQKSTSSGVLYRASS 69 ST++S+ +++S QV N A +++LR EPTFT S +S R K+ ++G+L SS Sbjct: 110 STKQSSNFSSTNKMS--QVVNFANSQKLRMEPTFTSSVISHR-----KTNANGILNGVSS 162 Query: 68 -GNAMLLGHLGNLKQPGGKNSTT 3 GN MLLG LGNLKQ +N ++ Sbjct: 163 TGNIMLLGQLGNLKQQKNQNGSS 185 >XP_011022777.1 PREDICTED: inactive TPR repeat-containing thioredoxin TTL3-like [Populus euphratica] Length = 606 Score = 57.8 bits (138), Expect = 6e-07 Identities = 32/66 (48%), Positives = 40/66 (60%) Frame = -2 Query: 200 SQVTNVAYTRRLRKEPTFTESELSMRIAVRQKSTSSGVLYRASSGNAMLLGHLGNLKQPG 21 +Q +V + RR+ KE EL I+ QKS S L RASS N MLLG+LGNL+Q G Sbjct: 121 NQNAHVKHGRRVPKEAVGLSGELESYISDHQKSKGSSTLVRASSSNVMLLGNLGNLRQGG 180 Query: 20 GKNSTT 3 G +TT Sbjct: 181 GGGNTT 186 >XP_016470146.1 PREDICTED: inactive TPR repeat-containing thioredoxin TTL3-like isoform X2 [Nicotiana tabacum] Length = 470 Score = 57.4 bits (137), Expect = 8e-07 Identities = 34/67 (50%), Positives = 44/67 (65%), Gaps = 1/67 (1%) Frame = -2 Query: 200 SQVTNVAYTRRLRKEPTFTESELSMRIAVRQKSTSSGVLYRASS-GNAMLLGHLGNLKQP 24 SQV N+A T++ R+EPTFT S+L T++G L RASS GN MLLG LGNLKQ Sbjct: 117 SQVVNLANTKKPRREPTFTPSDL----------TATGALNRASSTGNIMLLGQLGNLKQQ 166 Query: 23 GGKNSTT 3 +N ++ Sbjct: 167 KNQNGSS 173 >XP_016470144.1 PREDICTED: inactive TPR repeat-containing thioredoxin TTL3-like isoform X1 [Nicotiana tabacum] Length = 576 Score = 57.4 bits (137), Expect = 9e-07 Identities = 34/67 (50%), Positives = 44/67 (65%), Gaps = 1/67 (1%) Frame = -2 Query: 200 SQVTNVAYTRRLRKEPTFTESELSMRIAVRQKSTSSGVLYRASS-GNAMLLGHLGNLKQP 24 SQV N+A T++ R+EPTFT S+L T++G L RASS GN MLLG LGNLKQ Sbjct: 117 SQVVNLANTKKPRREPTFTPSDL----------TATGALNRASSTGNIMLLGQLGNLKQQ 166 Query: 23 GGKNSTT 3 +N ++ Sbjct: 167 KNQNGSS 173