BLASTX nr result
ID: Panax24_contig00016758
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00016758 (671 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017239677.1 PREDICTED: uncharacterized protein LOC108212461 [... 129 1e-36 GAV80311.1 DDE_4 domain-containing protein, partial [Cephalotus ... 133 3e-36 GAV56616.1 DDE_4 domain-containing protein, partial [Cephalotus ... 132 5e-36 GAV58743.1 DDE_4 domain-containing protein, partial [Cephalotus ... 132 1e-35 GAV67427.1 DDE_4 domain-containing protein [Cephalotus follicula... 134 6e-35 GAV58742.1 DDE_4 domain-containing protein [Cephalotus follicula... 133 2e-34 XP_019250881.1 PREDICTED: uncharacterized protein LOC109229783 [... 127 2e-34 GAV87383.1 LOW QUALITY PROTEIN: DDE_4 domain-containing protein,... 129 3e-34 GAV76392.1 LOW QUALITY PROTEIN: DDE_4 domain-containing protein,... 129 5e-34 XP_016458143.1 PREDICTED: uncharacterized protein LOC107781857 [... 130 6e-34 XP_009779131.1 PREDICTED: uncharacterized protein LOC104228372 [... 130 6e-34 GAV91946.1 LOW QUALITY PROTEIN: DDE_4 domain-containing protein ... 125 6e-34 XP_019262841.1 PREDICTED: uncharacterized protein LOC109240628 [... 125 8e-34 XP_009797411.1 PREDICTED: uncharacterized protein LOC104243848 [... 128 8e-34 GAV68136.1 LOW QUALITY PROTEIN: DDE_4 domain-containing protein ... 132 2e-33 XP_019251009.1 PREDICTED: uncharacterized protein LOC109229919 [... 124 2e-33 XP_019238923.1 PREDICTED: uncharacterized protein LOC109218976 [... 127 2e-33 GAV88573.1 DDE_4 domain-containing protein [Cephalotus follicula... 123 4e-33 GAV59443.1 DDE_4 domain-containing protein, partial [Cephalotus ... 127 4e-33 GAV71724.1 LOW QUALITY PROTEIN: DDE_4 domain-containing protein,... 127 5e-33 >XP_017239677.1 PREDICTED: uncharacterized protein LOC108212461 [Daucus carota subsp. sativus] Length = 335 Score = 129 bits (324), Expect(3) = 1e-36 Identities = 63/88 (71%), Positives = 70/88 (79%) Frame = -1 Query: 521 YLHILYWLADFRCRRALNKEEKFNHAHAQLRNVIERAYDVLKARFPIFKRMTLYPFIV*R 342 Y + YWLADFR +RAL KEEKFNHAHA+LRNVIERAY VLKARFPI K+M Y F R Sbjct: 200 YRNTRYWLADFRGQRALTKEEKFNHAHAKLRNVIERAYGVLKARFPILKQMAPYVFSTQR 259 Query: 341 DIVIACFAIHNFIRKHNIEDELFAQYDR 258 DIVIACFA+HNFIR +ED+LF Q DR Sbjct: 260 DIVIACFAVHNFIRMQKLEDQLFEQCDR 287 Score = 43.1 bits (100), Expect(3) = 1e-36 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -3 Query: 570 DKYYLCDAAYINTRGFLSPY 511 +KYYLCDAAY NTRGFL+PY Sbjct: 181 NKYYLCDAAYANTRGFLAPY 200 Score = 29.6 bits (65), Expect(3) = 1e-36 Identities = 13/17 (76%), Positives = 16/17 (94%) Frame = -3 Query: 171 EFMVNLREQIALQLLTT 121 +FM NLREQIAL+LLT+ Sbjct: 318 QFMTNLREQIALKLLTS 334 >GAV80311.1 DDE_4 domain-containing protein, partial [Cephalotus follicularis] Length = 344 Score = 133 bits (335), Expect(3) = 3e-36 Identities = 63/91 (69%), Positives = 73/91 (80%) Frame = -1 Query: 521 YLHILYWLADFRCRRALNKEEKFNHAHAQLRNVIERAYDVLKARFPIFKRMTLYPFIV*R 342 Y ++ YWL DFR RRA+ KEEKFNHAHA+LRNVIERAY VLKARFPI +M YPF V R Sbjct: 211 YRNVRYWLGDFRRRRAMTKEEKFNHAHAKLRNVIERAYGVLKARFPILDKMAPYPFNVQR 270 Query: 341 DIVIACFAIHNFIRKHNIEDELFAQYDRDNM 249 ++VIACFA++NFIRK I DELFAQY+ M Sbjct: 271 NVVIACFAVNNFIRKEKINDELFAQYEEPQM 301 Score = 42.0 bits (97), Expect(3) = 3e-36 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = -3 Query: 567 KYYLCDAAYINTRGFLSPY 511 KYYLCDAAY NTRGF++PY Sbjct: 193 KYYLCDAAYTNTRGFMAPY 211 Score = 25.4 bits (54), Expect(3) = 3e-36 Identities = 9/19 (47%), Positives = 16/19 (84%) Frame = -3 Query: 174 VEFMVNLREQIALQLLTTV 118 ++FM N+RE+IA+QL+ + Sbjct: 326 IQFMNNMREEIAVQLIGNI 344 >GAV56616.1 DDE_4 domain-containing protein, partial [Cephalotus follicularis] Length = 116 Score = 132 bits (331), Expect = 5e-36 Identities = 62/87 (71%), Positives = 72/87 (82%) Frame = -1 Query: 521 YLHILYWLADFRCRRALNKEEKFNHAHAQLRNVIERAYDVLKARFPIFKRMTLYPFIV*R 342 Y ++ YWL DFR RRA+ KEEKFNHAHA+LRNVIERAY VLKARFPI +M YPF V R Sbjct: 30 YRNVRYWLGDFRRRRAMTKEEKFNHAHAKLRNVIERAYGVLKARFPILDKMAPYPFNVQR 89 Query: 341 DIVIACFAIHNFIRKHNIEDELFAQYD 261 ++VIACFA++NFIRK I DELFAQY+ Sbjct: 90 NVVIACFAVNNFIRKEKINDELFAQYE 116 >GAV58743.1 DDE_4 domain-containing protein, partial [Cephalotus follicularis] Length = 346 Score = 132 bits (331), Expect(3) = 1e-35 Identities = 62/91 (68%), Positives = 72/91 (79%) Frame = -1 Query: 521 YLHILYWLADFRCRRALNKEEKFNHAHAQLRNVIERAYDVLKARFPIFKRMTLYPFIV*R 342 Y ++ YWL DFR RRA+ KEEKFNHAHA+LRNVIERAY VLK RFPI +M YPF V R Sbjct: 213 YRNVRYWLGDFRRRRAMTKEEKFNHAHAKLRNVIERAYGVLKTRFPILDKMAPYPFNVQR 272 Query: 341 DIVIACFAIHNFIRKHNIEDELFAQYDRDNM 249 ++VIACFA++NFIRK I DELFAQY+ M Sbjct: 273 NVVIACFAVNNFIRKEKINDELFAQYEEPQM 303 Score = 40.8 bits (94), Expect(3) = 1e-35 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -3 Query: 567 KYYLCDAAYINTRGFLSPY 511 KYYLCDAAY NTRGF+ PY Sbjct: 195 KYYLCDAAYTNTRGFMVPY 213 Score = 25.8 bits (55), Expect(3) = 1e-35 Identities = 9/19 (47%), Positives = 16/19 (84%) Frame = -3 Query: 174 VEFMVNLREQIALQLLTTV 118 ++FM N+RE+IA+QL+ + Sbjct: 328 IQFMSNMREEIAVQLIGNI 346 >GAV67427.1 DDE_4 domain-containing protein [Cephalotus follicularis] Length = 356 Score = 134 bits (336), Expect(2) = 6e-35 Identities = 62/91 (68%), Positives = 72/91 (79%) Frame = -1 Query: 521 YLHILYWLADFRCRRALNKEEKFNHAHAQLRNVIERAYDVLKARFPIFKRMTLYPFIV*R 342 Y ++ YWL DFRCRRA+ KEEKFNHAHA+LRNVIERAY VL ARFPI +M YPF V + Sbjct: 239 YRNVRYWLGDFRCRRAMTKEEKFNHAHAKLRNVIERAYGVLNARFPILDKMAPYPFNVQK 298 Query: 341 DIVIACFAIHNFIRKHNIEDELFAQYDRDNM 249 +IVIACF ++NFIRK I DELFAQY+ M Sbjct: 299 NIVIACFVVNNFIRKEKINDELFAQYEEPQM 329 Score = 42.0 bits (97), Expect(2) = 6e-35 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = -3 Query: 567 KYYLCDAAYINTRGFLSPY 511 KYYLCDAAY NTRGF++PY Sbjct: 221 KYYLCDAAYTNTRGFMAPY 239 >GAV58742.1 DDE_4 domain-containing protein [Cephalotus follicularis] Length = 297 Score = 133 bits (335), Expect(2) = 2e-34 Identities = 63/91 (69%), Positives = 73/91 (80%) Frame = -1 Query: 521 YLHILYWLADFRCRRALNKEEKFNHAHAQLRNVIERAYDVLKARFPIFKRMTLYPFIV*R 342 Y ++ YWL DFR RRA+ KEEKFNHAHA+LRNVIERAY VLKARFPI +M YPF V R Sbjct: 200 YRNVRYWLGDFRRRRAMTKEEKFNHAHAKLRNVIERAYGVLKARFPILDKMAPYPFNVQR 259 Query: 341 DIVIACFAIHNFIRKHNIEDELFAQYDRDNM 249 ++VIACFA++NFIRK I DELFAQY+ M Sbjct: 260 NVVIACFAVNNFIRKEKINDELFAQYEEPQM 290 Score = 40.8 bits (94), Expect(2) = 2e-34 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -3 Query: 567 KYYLCDAAYINTRGFLSPY 511 KYYLCDAAY NTRGF+ PY Sbjct: 182 KYYLCDAAYTNTRGFMVPY 200 >XP_019250881.1 PREDICTED: uncharacterized protein LOC109229783 [Nicotiana attenuata] Length = 278 Score = 127 bits (319), Expect(3) = 2e-34 Identities = 59/87 (67%), Positives = 69/87 (79%) Frame = -1 Query: 521 YLHILYWLADFRCRRALNKEEKFNHAHAQLRNVIERAYDVLKARFPIFKRMTLYPFIV*R 342 Y +I YWL D+ RRA+NKEEKFNHAHA+LRNVIERAY VLKARFPI +M Y V R Sbjct: 142 YRNIRYWLGDYHRRRAINKEEKFNHAHARLRNVIERAYGVLKARFPILDKMAPYSIDVQR 201 Query: 341 DIVIACFAIHNFIRKHNIEDELFAQYD 261 D+VIACFA+HNFIRK + D++F QYD Sbjct: 202 DVVIACFAVHNFIRKERLNDDMFNQYD 228 Score = 42.4 bits (98), Expect(3) = 2e-34 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -3 Query: 570 DKYYLCDAAYINTRGFLSPY 511 +KYYLCDAAY NTRGFL+PY Sbjct: 123 NKYYLCDAAYPNTRGFLAPY 142 Score = 25.0 bits (53), Expect(3) = 2e-34 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -3 Query: 171 EFMVNLREQIALQLL 127 +FM N+RE+IALQL+ Sbjct: 258 QFMNNMREEIALQLM 272 >GAV87383.1 LOW QUALITY PROTEIN: DDE_4 domain-containing protein, partial [Cephalotus follicularis] Length = 181 Score = 129 bits (325), Expect = 3e-34 Identities = 60/87 (68%), Positives = 72/87 (82%) Frame = -1 Query: 521 YLHILYWLADFRCRRALNKEEKFNHAHAQLRNVIERAYDVLKARFPIFKRMTLYPFIV*R 342 Y ++ YWL DFR RRA+ KEEKFNHAHA+LRN+IERAY VLK+RF IF +M YPF V R Sbjct: 95 YRNVRYWLGDFRRRRAITKEEKFNHAHAKLRNIIERAYGVLKSRFSIFDKMAPYPFNVQR 154 Query: 341 DIVIACFAIHNFIRKHNIEDELFAQYD 261 ++VIACFA++NFIRK I DELFAQY+ Sbjct: 155 NVVIACFAVNNFIRKEKINDELFAQYE 181 >GAV76392.1 LOW QUALITY PROTEIN: DDE_4 domain-containing protein, partial [Cephalotus follicularis] Length = 172 Score = 129 bits (323), Expect = 5e-34 Identities = 60/87 (68%), Positives = 71/87 (81%) Frame = -1 Query: 521 YLHILYWLADFRCRRALNKEEKFNHAHAQLRNVIERAYDVLKARFPIFKRMTLYPFIV*R 342 Y ++ YWL DFR RRA+ KEEKFNHAHA+LRNVIERAY VL RFPIF +M YPF V R Sbjct: 86 YHNVRYWLGDFRRRRAMTKEEKFNHAHAKLRNVIERAYGVLNTRFPIFDKMAPYPFNVQR 145 Query: 341 DIVIACFAIHNFIRKHNIEDELFAQYD 261 ++VIACFA++NFIRK I D+LFAQY+ Sbjct: 146 NVVIACFAVNNFIRKEKINDKLFAQYE 172 >XP_016458143.1 PREDICTED: uncharacterized protein LOC107781857 [Nicotiana tabacum] Length = 560 Score = 130 bits (326), Expect(2) = 6e-34 Identities = 62/87 (71%), Positives = 70/87 (80%) Frame = -1 Query: 521 YLHILYWLADFRCRRALNKEEKFNHAHAQLRNVIERAYDVLKARFPIFKRMTLYPFIV*R 342 Y +I YWL D+ RRA+NKEEKFNHAHAQLRNVIERAY VLKARFPI +M Y V R Sbjct: 433 YRNIRYWLGDYHRRRAINKEEKFNHAHAQLRNVIERAYRVLKARFPILDKMAPYSIDVQR 492 Query: 341 DIVIACFAIHNFIRKHNIEDELFAQYD 261 DIVIACFA+HNFIRK ++ D+LF QYD Sbjct: 493 DIVIACFAVHNFIRKEHLNDDLFNQYD 519 Score = 42.4 bits (98), Expect(2) = 6e-34 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -3 Query: 570 DKYYLCDAAYINTRGFLSPY 511 +KYYLCDAAY NTRGFL+PY Sbjct: 414 NKYYLCDAAYPNTRGFLAPY 433 >XP_009779131.1 PREDICTED: uncharacterized protein LOC104228372 [Nicotiana sylvestris] Length = 545 Score = 130 bits (326), Expect(2) = 6e-34 Identities = 62/87 (71%), Positives = 70/87 (80%) Frame = -1 Query: 521 YLHILYWLADFRCRRALNKEEKFNHAHAQLRNVIERAYDVLKARFPIFKRMTLYPFIV*R 342 Y +I YWL D+ RRA+NKEEKFNHAHAQLRNVIERAY VLKARFPI +M Y V R Sbjct: 418 YRNIRYWLGDYHRRRAINKEEKFNHAHAQLRNVIERAYRVLKARFPILDKMAPYSIDVQR 477 Query: 341 DIVIACFAIHNFIRKHNIEDELFAQYD 261 DIVIACFA+HNFIRK ++ D+LF QYD Sbjct: 478 DIVIACFAVHNFIRKEHLNDDLFNQYD 504 Score = 42.4 bits (98), Expect(2) = 6e-34 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -3 Query: 570 DKYYLCDAAYINTRGFLSPY 511 +KYYLCDAAY NTRGFL+PY Sbjct: 399 NKYYLCDAAYPNTRGFLAPY 418 >GAV91946.1 LOW QUALITY PROTEIN: DDE_4 domain-containing protein [Cephalotus follicularis] Length = 332 Score = 125 bits (315), Expect(3) = 6e-34 Identities = 60/91 (65%), Positives = 71/91 (78%) Frame = -1 Query: 521 YLHILYWLADFRCRRALNKEEKFNHAHAQLRNVIERAYDVLKARFPIFKRMTLYPFIV*R 342 Y ++ Y L DFR RRA+ KEEKFNHAHA+LRNVIERAY VLKARFPI +M YPF V R Sbjct: 199 YYNVRYCLGDFRRRRAMTKEEKFNHAHAKLRNVIERAYGVLKARFPILDKMAPYPFNVQR 258 Query: 341 DIVIACFAIHNFIRKHNIEDELFAQYDRDNM 249 ++VIACFA++NFIRK I DELF Q++ M Sbjct: 259 NVVIACFAVNNFIRKEKINDELFVQFEEPQM 289 Score = 42.0 bits (97), Expect(3) = 6e-34 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = -3 Query: 567 KYYLCDAAYINTRGFLSPY 511 KYYLCDAAY NTRGF++PY Sbjct: 181 KYYLCDAAYTNTRGFMAPY 199 Score = 25.0 bits (53), Expect(3) = 6e-34 Identities = 8/19 (42%), Positives = 16/19 (84%) Frame = -3 Query: 174 VEFMVNLREQIALQLLTTV 118 ++FM N+RE+I++QL+ + Sbjct: 314 IQFMSNMREEISVQLIENI 332 >XP_019262841.1 PREDICTED: uncharacterized protein LOC109240628 [Nicotiana attenuata] Length = 358 Score = 125 bits (315), Expect(3) = 8e-34 Identities = 59/87 (67%), Positives = 68/87 (78%) Frame = -1 Query: 521 YLHILYWLADFRCRRALNKEEKFNHAHAQLRNVIERAYDVLKARFPIFKRMTLYPFIV*R 342 Y +I YWL D+ RRA+NKEEKFNHAHAQLRNVIER Y VLKARF I +M Y V R Sbjct: 210 YHNIRYWLGDYHRRRAINKEEKFNHAHAQLRNVIERVYGVLKARFSILDKMVPYSIDVQR 269 Query: 341 DIVIACFAIHNFIRKHNIEDELFAQYD 261 D+VIACFA+HNFIRK + D+LF+QYD Sbjct: 270 DVVIACFAVHNFIRKERLNDDLFSQYD 296 Score = 42.4 bits (98), Expect(3) = 8e-34 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -3 Query: 570 DKYYLCDAAYINTRGFLSPY 511 +KYYLCDAAY NTRGFL+PY Sbjct: 191 NKYYLCDAAYPNTRGFLAPY 210 Score = 24.3 bits (51), Expect(3) = 8e-34 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -3 Query: 171 EFMVNLREQIALQLL 127 +FM N+RE++ALQL+ Sbjct: 326 QFMNNMREELALQLM 340 >XP_009797411.1 PREDICTED: uncharacterized protein LOC104243848 [Nicotiana sylvestris] Length = 169 Score = 128 bits (321), Expect = 8e-34 Identities = 60/87 (68%), Positives = 68/87 (78%) Frame = -1 Query: 521 YLHILYWLADFRCRRALNKEEKFNHAHAQLRNVIERAYDVLKARFPIFKRMTLYPFIV*R 342 Y +I YWL D+ RRA+NKEEKFNHAHAQLRNVIERAY V KARFPI +M Y V R Sbjct: 33 YRNIRYWLGDYHRRRAINKEEKFNHAHAQLRNVIERAYGVFKARFPILDKMAPYSIDVQR 92 Query: 341 DIVIACFAIHNFIRKHNIEDELFAQYD 261 D+VIACFA+HNFIRK + D+LF QYD Sbjct: 93 DVVIACFAVHNFIRKERLNDDLFNQYD 119 >GAV68136.1 LOW QUALITY PROTEIN: DDE_4 domain-containing protein [Cephalotus follicularis] Length = 330 Score = 132 bits (331), Expect = 2e-33 Identities = 63/92 (68%), Positives = 73/92 (79%) Frame = -1 Query: 524 FYLHILYWLADFRCRRALNKEEKFNHAHAQLRNVIERAYDVLKARFPIFKRMTLYPFIV* 345 F + YWL DFR RRA+ KEEKFNHAHA+LRNVIERAY VLKARFPI +M YPF V Sbjct: 196 FMAPVRYWLEDFRRRRAMTKEEKFNHAHAKLRNVIERAYGVLKARFPILDKMAPYPFNVQ 255 Query: 344 RDIVIACFAIHNFIRKHNIEDELFAQYDRDNM 249 R++VIACFA++NFIRK I DELFAQY+ +M Sbjct: 256 RNVVIACFAVNNFIRKEKINDELFAQYEEPHM 287 >XP_019251009.1 PREDICTED: uncharacterized protein LOC109229919 [Nicotiana attenuata] Length = 336 Score = 124 bits (310), Expect(3) = 2e-33 Identities = 58/87 (66%), Positives = 68/87 (78%) Frame = -1 Query: 521 YLHILYWLADFRCRRALNKEEKFNHAHAQLRNVIERAYDVLKARFPIFKRMTLYPFIV*R 342 Y +I YWL D+ RRA+NKEEKFNHAHA+LRNVIERAY VLKARFPI +M V R Sbjct: 200 YRNIRYWLGDYHRRRAINKEEKFNHAHARLRNVIERAYGVLKARFPILDKMAPNSIDVQR 259 Query: 341 DIVIACFAIHNFIRKHNIEDELFAQYD 261 D+VIACFA+HNFIRK + D++F QYD Sbjct: 260 DVVIACFAVHNFIRKERLNDDMFNQYD 286 Score = 42.4 bits (98), Expect(3) = 2e-33 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -3 Query: 570 DKYYLCDAAYINTRGFLSPY 511 +KYYLCDAAY NTRGFL+PY Sbjct: 181 NKYYLCDAAYPNTRGFLAPY 200 Score = 25.0 bits (53), Expect(3) = 2e-33 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -3 Query: 171 EFMVNLREQIALQLL 127 +FM N+RE+IALQL+ Sbjct: 316 QFMNNMREEIALQLM 330 >XP_019238923.1 PREDICTED: uncharacterized protein LOC109218976 [Nicotiana attenuata] Length = 192 Score = 127 bits (320), Expect = 2e-33 Identities = 60/87 (68%), Positives = 69/87 (79%) Frame = -1 Query: 521 YLHILYWLADFRCRRALNKEEKFNHAHAQLRNVIERAYDVLKARFPIFKRMTLYPFIV*R 342 Y +I YWL D+ RRA+NKEEKFNHAHA+LRNVIERAY VLKARFPI +M Y V R Sbjct: 56 YHNIRYWLGDYHRRRAINKEEKFNHAHARLRNVIERAYGVLKARFPILDKMAPYSIDVQR 115 Query: 341 DIVIACFAIHNFIRKHNIEDELFAQYD 261 D+VIACFA+HNFIRK + D+LF QYD Sbjct: 116 DVVIACFAVHNFIRKERLNDDLFNQYD 142 >GAV88573.1 DDE_4 domain-containing protein [Cephalotus follicularis] Length = 371 Score = 123 bits (309), Expect(3) = 4e-33 Identities = 60/87 (68%), Positives = 69/87 (79%) Frame = -1 Query: 521 YLHILYWLADFRCRRALNKEEKFNHAHAQLRNVIERAYDVLKARFPIFKRMTLYPFIV*R 342 Y ++ YWL DFR RA+ KEEKFNHAHA+LRNVIE AY VLKARFPI +M YPF V R Sbjct: 239 YRNVRYWLRDFRRGRAMTKEEKFNHAHAKLRNVIECAYGVLKARFPILDKMAPYPFNVQR 298 Query: 341 DIVIACFAIHNFIRKHNIEDELFAQYD 261 + VIACFA++NFIRK I DELFAQY+ Sbjct: 299 NEVIACFAVNNFIRKEKINDELFAQYE 325 Score = 42.4 bits (98), Expect(3) = 4e-33 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = -3 Query: 570 DKYYLCDAAYINTRGFLSPY 511 +KYYLCDAAY NTRGF++PY Sbjct: 220 NKYYLCDAAYTNTRGFMAPY 239 Score = 24.3 bits (51), Expect(3) = 4e-33 Identities = 8/19 (42%), Positives = 15/19 (78%) Frame = -3 Query: 174 VEFMVNLREQIALQLLTTV 118 ++FM N+RE+I +QL+ + Sbjct: 353 IQFMSNMREEIVVQLIGNI 371 >GAV59443.1 DDE_4 domain-containing protein, partial [Cephalotus follicularis] Length = 309 Score = 127 bits (320), Expect(2) = 4e-33 Identities = 60/87 (68%), Positives = 70/87 (80%) Frame = -1 Query: 521 YLHILYWLADFRCRRALNKEEKFNHAHAQLRNVIERAYDVLKARFPIFKRMTLYPFIV*R 342 Y ++ YWL DF RRA+ KEEKFNHAHA+LRNVIERAY VLKARFPI +M YPF V R Sbjct: 223 YRNVRYWLGDFSRRRAMTKEEKFNHAHAKLRNVIERAYGVLKARFPILDKMDPYPFNVQR 282 Query: 341 DIVIACFAIHNFIRKHNIEDELFAQYD 261 ++VIACFA++NFIRK I DELF QY+ Sbjct: 283 NVVIACFAVNNFIRKEKINDELFVQYE 309 Score = 42.0 bits (97), Expect(2) = 4e-33 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = -3 Query: 567 KYYLCDAAYINTRGFLSPY 511 KYYLCDAAY NTRGF++PY Sbjct: 205 KYYLCDAAYTNTRGFMAPY 223 >GAV71724.1 LOW QUALITY PROTEIN: DDE_4 domain-containing protein, partial [Cephalotus follicularis] Length = 310 Score = 127 bits (319), Expect(2) = 5e-33 Identities = 61/87 (70%), Positives = 72/87 (82%) Frame = -1 Query: 521 YLHILYWLADFRCRRALNKEEKFNHAHAQLRNVIERAYDVLKARFPIFKRMTLYPFIV*R 342 Y ++ YWL DFR RRA+ KEEKFNHAHA+LRNVI+RAY VLKARFPI +M YPF V R Sbjct: 225 YRNVRYWLGDFRRRRAMTKEEKFNHAHAKLRNVIKRAYGVLKARFPILDKMAPYPFNV-R 283 Query: 341 DIVIACFAIHNFIRKHNIEDELFAQYD 261 ++VIACFA++NFIRK I DELFAQY+ Sbjct: 284 NVVIACFAVNNFIRKEKINDELFAQYE 310 Score = 42.0 bits (97), Expect(2) = 5e-33 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = -3 Query: 567 KYYLCDAAYINTRGFLSPY 511 KYYLCDAAY NTRGF++PY Sbjct: 207 KYYLCDAAYTNTRGFMAPY 225