BLASTX nr result
ID: Panax24_contig00016515
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00016515 (382 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012852188.1 PREDICTED: protein IQ-DOMAIN 14-like [Erythranthe... 57 8e-07 >XP_012852188.1 PREDICTED: protein IQ-DOMAIN 14-like [Erythranthe guttata] EYU25070.1 hypothetical protein MIMGU_mgv1a007392mg [Erythranthe guttata] Length = 409 Score = 56.6 bits (135), Expect = 8e-07 Identities = 38/89 (42%), Positives = 42/89 (47%), Gaps = 6/89 (6%) Frame = -2 Query: 297 RLTSGGSRGTYV------GDRRRELAAVKIQSAFRXXXXXXXXXXXXXXXXXXXLVRGHI 136 RLTSGG G V GDRRR AA+KIQSAFR +VRGHI Sbjct: 97 RLTSGGGSGRNVVRSYIGGDRRRVTAAIKIQSAFRAYLARRALRALKGLVKLQAIVRGHI 156 Query: 135 VRKQSTHMLHXXXXXXXXXXXXXAHRAYM 49 VRKQS ML AHR+Y+ Sbjct: 157 VRKQSAEMLRRMQSMARIQARASAHRSYL 185