BLASTX nr result
ID: Panax24_contig00016283
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00016283 (664 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFK36952.1 unknown [Lotus japonicus] 59 5e-08 XP_009587293.2 PREDICTED: lipoyl synthase 2, mitochondrial-like,... 61 1e-07 XP_016470745.1 PREDICTED: lipoyl synthase 2, mitochondrial-like ... 61 2e-07 XP_012088337.1 PREDICTED: lipoyl synthase, mitochondrial [Jatrop... 61 2e-07 XP_019266153.1 PREDICTED: lipoyl synthase 2, mitochondrial-like ... 61 2e-07 XP_009778191.1 PREDICTED: lipoyl synthase 2, mitochondrial-like ... 61 2e-07 XP_019158703.1 PREDICTED: lipoyl synthase 2, mitochondrial-like ... 61 2e-07 XP_019158701.1 PREDICTED: lipoyl synthase, mitochondrial-like is... 61 2e-07 XP_004245423.1 PREDICTED: lipoyl synthase 1, mitochondrial-like ... 60 3e-07 OAY34099.1 hypothetical protein MANES_13G149900 [Manihot esculenta] 60 3e-07 XP_007149469.1 hypothetical protein PHAVU_005G072800g [Phaseolus... 60 3e-07 KOM43586.1 hypothetical protein LR48_Vigan05g119100 [Vigna angul... 60 3e-07 KYP35828.1 hypothetical protein KK1_043119 [Cajanus cajan] 60 3e-07 XP_015082669.1 PREDICTED: lipoyl synthase 1, mitochondrial [Sola... 60 3e-07 XP_006357526.1 PREDICTED: lipoyl synthase 1, mitochondrial [Sola... 60 3e-07 XP_004243321.1 PREDICTED: lipoyl synthase, mitochondrial [Solanu... 60 3e-07 XP_017422938.1 PREDICTED: lipoyl synthase 2, mitochondrial [Vign... 60 3e-07 XP_017425119.1 PREDICTED: lipoyl synthase 1, mitochondrial-like ... 60 3e-07 XP_014492551.1 PREDICTED: lipoyl synthase 2, mitochondrial [Vign... 60 3e-07 XP_014491764.1 PREDICTED: lipoyl synthase 1, mitochondrial [Vign... 60 3e-07 >AFK36952.1 unknown [Lotus japonicus] Length = 116 Score = 59.3 bits (142), Expect = 5e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 662 FRYVASGSMVRLSYKAGEFYIKSMIESDRAAS 567 FRYVASG MVR SYKAGEFYIKSMI+SDRAAS Sbjct: 78 FRYVASGPMVRSSYKAGEFYIKSMIDSDRAAS 109 >XP_009587293.2 PREDICTED: lipoyl synthase 2, mitochondrial-like, partial [Nicotiana tomentosiformis] Length = 248 Score = 60.8 bits (146), Expect = 1e-07 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -3 Query: 662 FRYVASGSMVRLSYKAGEFYIKSMIESDRAASFI 561 FRYVASG MVR SYKAGEFYIKSMIESDRAAS + Sbjct: 215 FRYVASGPMVRSSYKAGEFYIKSMIESDRAASSV 248 >XP_016470745.1 PREDICTED: lipoyl synthase 2, mitochondrial-like [Nicotiana tabacum] Length = 301 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -3 Query: 662 FRYVASGSMVRLSYKAGEFYIKSMIESDRAASFI 561 FRYVASG MVR SYKAGEFYIKSMIESDRAAS + Sbjct: 268 FRYVASGPMVRSSYKAGEFYIKSMIESDRAASSV 301 >XP_012088337.1 PREDICTED: lipoyl synthase, mitochondrial [Jatropha curcas] KDP24175.1 hypothetical protein JCGZ_25832 [Jatropha curcas] Length = 377 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = -3 Query: 662 FRYVASGSMVRLSYKAGEFYIKSMIESDRAASFILMLA 549 FRYVASG MVR SYKAGEFYIKSMIESDRAAS L ++ Sbjct: 340 FRYVASGPMVRSSYKAGEFYIKSMIESDRAASSQLSIS 377 >XP_019266153.1 PREDICTED: lipoyl synthase 2, mitochondrial-like [Nicotiana attenuata] OIT35220.1 lipoyl synthase, mitochondrial [Nicotiana attenuata] Length = 384 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -3 Query: 662 FRYVASGSMVRLSYKAGEFYIKSMIESDRAASFI 561 FRYVASG MVR SYKAGEFYIKSMIESDRAAS + Sbjct: 351 FRYVASGPMVRSSYKAGEFYIKSMIESDRAASSV 384 >XP_009778191.1 PREDICTED: lipoyl synthase 2, mitochondrial-like [Nicotiana sylvestris] XP_016449960.1 PREDICTED: lipoyl synthase 2, mitochondrial-like [Nicotiana tabacum] Length = 384 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -3 Query: 662 FRYVASGSMVRLSYKAGEFYIKSMIESDRAASFI 561 FRYVASG MVR SYKAGEFYIKSMIESDRAAS + Sbjct: 351 FRYVASGPMVRSSYKAGEFYIKSMIESDRAASSV 384 >XP_019158703.1 PREDICTED: lipoyl synthase 2, mitochondrial-like isoform X2 [Ipomoea nil] Length = 385 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -3 Query: 662 FRYVASGSMVRLSYKAGEFYIKSMIESDRAASFI 561 FRYVASG MVR SYKAGEFYIKSMIESDRAAS + Sbjct: 352 FRYVASGPMVRSSYKAGEFYIKSMIESDRAASSV 385 >XP_019158701.1 PREDICTED: lipoyl synthase, mitochondrial-like isoform X1 [Ipomoea nil] Length = 412 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -3 Query: 662 FRYVASGSMVRLSYKAGEFYIKSMIESDRAASFI 561 FRYVASG MVR SYKAGEFYIKSMIESDRAAS + Sbjct: 379 FRYVASGPMVRSSYKAGEFYIKSMIESDRAASSV 412 >XP_004245423.1 PREDICTED: lipoyl synthase 1, mitochondrial-like [Solanum lycopersicum] Length = 313 Score = 60.5 bits (145), Expect = 3e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -3 Query: 662 FRYVASGSMVRLSYKAGEFYIKSMIESDRAAS 567 FRYVASG MVR SYKAGEFYIKSMIESDRAAS Sbjct: 280 FRYVASGPMVRSSYKAGEFYIKSMIESDRAAS 311 >OAY34099.1 hypothetical protein MANES_13G149900 [Manihot esculenta] Length = 377 Score = 60.5 bits (145), Expect = 3e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -3 Query: 662 FRYVASGSMVRLSYKAGEFYIKSMIESDRAAS 567 FRYVASG MVR SYKAGEFYIKSMIESDRAAS Sbjct: 340 FRYVASGPMVRSSYKAGEFYIKSMIESDRAAS 371 >XP_007149469.1 hypothetical protein PHAVU_005G072800g [Phaseolus vulgaris] ESW21463.1 hypothetical protein PHAVU_005G072800g [Phaseolus vulgaris] Length = 377 Score = 60.5 bits (145), Expect = 3e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -3 Query: 662 FRYVASGSMVRLSYKAGEFYIKSMIESDRAAS 567 FRYVASG MVR SYKAGEFYIKSMIESDRAAS Sbjct: 343 FRYVASGPMVRSSYKAGEFYIKSMIESDRAAS 374 >KOM43586.1 hypothetical protein LR48_Vigan05g119100 [Vigna angularis] Length = 379 Score = 60.5 bits (145), Expect = 3e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -3 Query: 662 FRYVASGSMVRLSYKAGEFYIKSMIESDRAAS 567 FRYVASG MVR SYKAGEFYIKSMIESDRAAS Sbjct: 341 FRYVASGPMVRSSYKAGEFYIKSMIESDRAAS 372 >KYP35828.1 hypothetical protein KK1_043119 [Cajanus cajan] Length = 380 Score = 60.5 bits (145), Expect = 3e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -3 Query: 662 FRYVASGSMVRLSYKAGEFYIKSMIESDRAAS 567 FRYVASG MVR SYKAGEFYIKSMIESDRAAS Sbjct: 342 FRYVASGPMVRSSYKAGEFYIKSMIESDRAAS 373 >XP_015082669.1 PREDICTED: lipoyl synthase 1, mitochondrial [Solanum pennellii] Length = 380 Score = 60.5 bits (145), Expect = 3e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -3 Query: 662 FRYVASGSMVRLSYKAGEFYIKSMIESDRAAS 567 FRYVASG MVR SYKAGEFYIKSMIESDRAAS Sbjct: 347 FRYVASGPMVRSSYKAGEFYIKSMIESDRAAS 378 >XP_006357526.1 PREDICTED: lipoyl synthase 1, mitochondrial [Solanum tuberosum] Length = 380 Score = 60.5 bits (145), Expect = 3e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -3 Query: 662 FRYVASGSMVRLSYKAGEFYIKSMIESDRAAS 567 FRYVASG MVR SYKAGEFYIKSMIESDRAAS Sbjct: 347 FRYVASGPMVRSSYKAGEFYIKSMIESDRAAS 378 >XP_004243321.1 PREDICTED: lipoyl synthase, mitochondrial [Solanum lycopersicum] Length = 380 Score = 60.5 bits (145), Expect = 3e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -3 Query: 662 FRYVASGSMVRLSYKAGEFYIKSMIESDRAAS 567 FRYVASG MVR SYKAGEFYIKSMIESDRAAS Sbjct: 347 FRYVASGPMVRSSYKAGEFYIKSMIESDRAAS 378 >XP_017422938.1 PREDICTED: lipoyl synthase 2, mitochondrial [Vigna angularis] BAT92575.1 hypothetical protein VIGAN_07133000 [Vigna angularis var. angularis] Length = 381 Score = 60.5 bits (145), Expect = 3e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -3 Query: 662 FRYVASGSMVRLSYKAGEFYIKSMIESDRAAS 567 FRYVASG MVR SYKAGEFYIKSMIESDRAAS Sbjct: 343 FRYVASGPMVRSSYKAGEFYIKSMIESDRAAS 374 >XP_017425119.1 PREDICTED: lipoyl synthase 1, mitochondrial-like [Vigna angularis] BAT92259.1 hypothetical protein VIGAN_07094500 [Vigna angularis var. angularis] Length = 381 Score = 60.5 bits (145), Expect = 3e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -3 Query: 662 FRYVASGSMVRLSYKAGEFYIKSMIESDRAAS 567 FRYVASG MVR SYKAGEFYIKSMIESDRAAS Sbjct: 343 FRYVASGPMVRSSYKAGEFYIKSMIESDRAAS 374 >XP_014492551.1 PREDICTED: lipoyl synthase 2, mitochondrial [Vigna radiata var. radiata] Length = 381 Score = 60.5 bits (145), Expect = 3e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -3 Query: 662 FRYVASGSMVRLSYKAGEFYIKSMIESDRAAS 567 FRYVASG MVR SYKAGEFYIKSMIESDRAAS Sbjct: 343 FRYVASGPMVRSSYKAGEFYIKSMIESDRAAS 374 >XP_014491764.1 PREDICTED: lipoyl synthase 1, mitochondrial [Vigna radiata var. radiata] Length = 381 Score = 60.5 bits (145), Expect = 3e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -3 Query: 662 FRYVASGSMVRLSYKAGEFYIKSMIESDRAAS 567 FRYVASG MVR SYKAGEFYIKSMIESDRAAS Sbjct: 343 FRYVASGPMVRSSYKAGEFYIKSMIESDRAAS 374