BLASTX nr result
ID: Panax24_contig00016138
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00016138 (351 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_002272158.1 PREDICTED: acetylornithine aminotransferase, mito... 64 2e-09 >XP_002272158.1 PREDICTED: acetylornithine aminotransferase, mitochondrial [Vitis vinifera] Length = 463 Score = 63.5 bits (153), Expect = 2e-09 Identities = 38/77 (49%), Positives = 47/77 (61%), Gaps = 1/77 (1%) Frame = +1 Query: 124 MSSVYLFHSYAFLRTTDLRRSITPTFSASSNGGRMSACLAADVQK-ASSDSTKLALEVAS 300 M+S+ + +DLR S + S SSNGGR AC+ VQ S DS K+ AS Sbjct: 1 MASIQFLLNNTLPSASDLRHSFSG-LSGSSNGGRAIACVKVGVQAPGSGDSGKMGFRGAS 59 Query: 301 KEVMEADGRVMVGTYAR 351 KEVMEA+GR+MVGTYAR Sbjct: 60 KEVMEAEGRLMVGTYAR 76