BLASTX nr result
ID: Panax24_contig00016090
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00016090 (379 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015387575.1 PREDICTED: F-box protein CPR30-like [Citrus sinen... 79 6e-16 XP_006437454.1 hypothetical protein CICLE_v10033971mg [Citrus cl... 79 9e-15 XP_006484611.1 PREDICTED: F-box protein CPR30-like isoform X2 [C... 79 9e-15 XP_015387602.1 PREDICTED: F-box protein CPR30-like isoform X1 [C... 79 1e-14 KDO49218.1 hypothetical protein CISIN_1g037535mg, partial [Citru... 76 2e-14 XP_012078088.1 PREDICTED: F-box protein CPR30-like [Jatropha cur... 77 7e-14 XP_006437453.1 hypothetical protein CICLE_v10033794mg [Citrus cl... 73 1e-13 OMP08782.1 hypothetical protein COLO4_06115 [Corchorus olitorius] 74 2e-13 CDP04487.1 unnamed protein product [Coffea canephora] 75 3e-13 XP_006487903.1 PREDICTED: F-box protein CPR30 [Citrus sinensis] 74 4e-13 KDO36510.1 hypothetical protein CISIN_1g016891mg [Citrus sinensis] 74 4e-13 XP_006437455.1 hypothetical protein CICLE_v10033474mg [Citrus cl... 74 4e-13 XP_006424213.1 hypothetical protein CICLE_v10028697mg [Citrus cl... 74 5e-13 OMP08780.1 hypothetical protein COLO4_06128 [Corchorus olitorius] 73 8e-13 CDP03320.1 unnamed protein product [Coffea canephora] 74 8e-13 EEF29664.1 conserved hypothetical protein [Ricinus communis] 74 8e-13 XP_002532715.2 PREDICTED: F-box protein CPR30 [Ricinus communis] 74 8e-13 XP_019155681.1 PREDICTED: F-box protein CPR30-like isoform X1 [I... 73 1e-12 XP_011096147.1 PREDICTED: uncharacterized protein LOC105175410 [... 73 1e-12 XP_016693318.1 PREDICTED: F-box protein CPR30-like [Gossypium hi... 73 2e-12 >XP_015387575.1 PREDICTED: F-box protein CPR30-like [Citrus sinensis] Length = 171 Score = 79.0 bits (193), Expect = 6e-16 Identities = 39/60 (65%), Positives = 49/60 (81%) Frame = +1 Query: 187 MSDIPAEVLGDILSRLPVKSLLRSRCVSKPFCALIDSPEFIKVQLDYSTKTNSNLTIILS 366 M+ +P ++ DILSRLPVKSLLR +CVSK FC+LIDS EFIK+ L S +TNSNL++ILS Sbjct: 1 MARLPTDINIDILSRLPVKSLLRFKCVSKSFCSLIDSQEFIKIHLKRSIETNSNLSLILS 60 >XP_006437454.1 hypothetical protein CICLE_v10033971mg [Citrus clementina] ESR50694.1 hypothetical protein CICLE_v10033971mg [Citrus clementina] Length = 386 Score = 79.0 bits (193), Expect = 9e-15 Identities = 39/60 (65%), Positives = 49/60 (81%) Frame = +1 Query: 187 MSDIPAEVLGDILSRLPVKSLLRSRCVSKPFCALIDSPEFIKVQLDYSTKTNSNLTIILS 366 M+ +P ++ DILSRLPVKSLLR +CVSK FC+LIDS EFIK+ L S +TNSNL++ILS Sbjct: 1 MARLPTDINIDILSRLPVKSLLRFKCVSKSFCSLIDSQEFIKIHLKRSIETNSNLSLILS 60 >XP_006484611.1 PREDICTED: F-box protein CPR30-like isoform X2 [Citrus sinensis] Length = 397 Score = 79.0 bits (193), Expect = 9e-15 Identities = 39/60 (65%), Positives = 49/60 (81%) Frame = +1 Query: 187 MSDIPAEVLGDILSRLPVKSLLRSRCVSKPFCALIDSPEFIKVQLDYSTKTNSNLTIILS 366 M+ +P ++ DILSRLPVKSLLR +CVSK FC+LIDS EFIK+ L S +TNSNL++ILS Sbjct: 1 MARLPTDINIDILSRLPVKSLLRFKCVSKSFCSLIDSQEFIKIHLKRSIETNSNLSLILS 60 >XP_015387602.1 PREDICTED: F-box protein CPR30-like isoform X1 [Citrus sinensis] Length = 401 Score = 79.0 bits (193), Expect = 1e-14 Identities = 39/60 (65%), Positives = 49/60 (81%) Frame = +1 Query: 187 MSDIPAEVLGDILSRLPVKSLLRSRCVSKPFCALIDSPEFIKVQLDYSTKTNSNLTIILS 366 M+ +P ++ DILSRLPVKSLLR +CVSK FC+LIDS EFIK+ L S +TNSNL++ILS Sbjct: 1 MARLPTDINIDILSRLPVKSLLRFKCVSKSFCSLIDSQEFIKIHLKRSIETNSNLSLILS 60 >KDO49218.1 hypothetical protein CISIN_1g037535mg, partial [Citrus sinensis] Length = 216 Score = 75.9 bits (185), Expect = 2e-14 Identities = 37/60 (61%), Positives = 48/60 (80%) Frame = +1 Query: 187 MSDIPAEVLGDILSRLPVKSLLRSRCVSKPFCALIDSPEFIKVQLDYSTKTNSNLTIILS 366 M+ +P ++ DILSRLPVKSLLR +C+SK FC+LI S EFIK+ L S +TNSNL++ILS Sbjct: 1 MASLPTDIKIDILSRLPVKSLLRFKCMSKSFCSLIASQEFIKIHLKRSIETNSNLSLILS 60 >XP_012078088.1 PREDICTED: F-box protein CPR30-like [Jatropha curcas] KDP32919.1 hypothetical protein JCGZ_13700 [Jatropha curcas] Length = 413 Score = 76.6 bits (187), Expect = 7e-14 Identities = 36/59 (61%), Positives = 47/59 (79%) Frame = +1 Query: 187 MSDIPAEVLGDILSRLPVKSLLRSRCVSKPFCALIDSPEFIKVQLDYSTKTNSNLTIIL 363 MS IP +V+ DIL +LPVKSLLR RC+SKP C+LID P+FI + L +S +T SNL++IL Sbjct: 1 MSKIPHDVINDILLQLPVKSLLRFRCLSKPLCSLIDGPDFIHLHLSHSLQTRSNLSLIL 59 >XP_006437453.1 hypothetical protein CICLE_v10033794mg [Citrus clementina] ESR50693.1 hypothetical protein CICLE_v10033794mg [Citrus clementina] Length = 173 Score = 72.8 bits (177), Expect = 1e-13 Identities = 36/60 (60%), Positives = 47/60 (78%) Frame = +1 Query: 187 MSDIPAEVLGDILSRLPVKSLLRSRCVSKPFCALIDSPEFIKVQLDYSTKTNSNLTIILS 366 M+ +P ++ DILSRL VK LLR +CVSK FC+LIDS EFIK+ L S +T+SNL++ILS Sbjct: 1 MAKLPTDINMDILSRLSVKCLLRFKCVSKSFCSLIDSQEFIKIHLKRSIETSSNLSLILS 60 >OMP08782.1 hypothetical protein COLO4_06115 [Corchorus olitorius] Length = 284 Score = 74.3 bits (181), Expect = 2e-13 Identities = 33/59 (55%), Positives = 47/59 (79%) Frame = +1 Query: 187 MSDIPAEVLGDILSRLPVKSLLRSRCVSKPFCALIDSPEFIKVQLDYSTKTNSNLTIIL 363 M+ IP +++ DIL RL V+ LLR RC+SKP+C+LIDSP FIK+ L +S KT++ L++IL Sbjct: 1 MASIPLDIINDILCRLSVEDLLRFRCISKPWCSLIDSPNFIKLHLSHSLKTHTRLSLIL 59 >CDP04487.1 unnamed protein product [Coffea canephora] Length = 382 Score = 74.7 bits (182), Expect = 3e-13 Identities = 37/59 (62%), Positives = 47/59 (79%) Frame = +1 Query: 187 MSDIPAEVLGDILSRLPVKSLLRSRCVSKPFCALIDSPEFIKVQLDYSTKTNSNLTIIL 363 M ++P E++ DIL+RLPVKSLLR RCVSKP+C+LIDS FIK+ L S KT SNL ++L Sbjct: 1 MPNLPRELITDILTRLPVKSLLRFRCVSKPWCSLIDSRSFIKMHLLQSKKTGSNLFLML 59 >XP_006487903.1 PREDICTED: F-box protein CPR30 [Citrus sinensis] Length = 366 Score = 74.3 bits (181), Expect = 4e-13 Identities = 34/59 (57%), Positives = 48/59 (81%) Frame = +1 Query: 187 MSDIPAEVLGDILSRLPVKSLLRSRCVSKPFCALIDSPEFIKVQLDYSTKTNSNLTIIL 363 MS +P +++ DILSRLPVK LLR RCVSK FC+LIDS +F+K+ L+ + +TNS L++I+ Sbjct: 1 MSSLPLDLISDILSRLPVKPLLRFRCVSKCFCSLIDSQDFVKLHLNQAIETNSGLSLIV 59 >KDO36510.1 hypothetical protein CISIN_1g016891mg [Citrus sinensis] Length = 381 Score = 74.3 bits (181), Expect = 4e-13 Identities = 37/60 (61%), Positives = 47/60 (78%) Frame = +1 Query: 187 MSDIPAEVLGDILSRLPVKSLLRSRCVSKPFCALIDSPEFIKVQLDYSTKTNSNLTIILS 366 M+ +P ++ DILSRL VK LLR +CVSK FC+LIDS EFIK+ L S +TNSNL++ILS Sbjct: 1 MAGLPTDINIDILSRLSVKCLLRFKCVSKSFCSLIDSQEFIKIHLKRSIETNSNLSLILS 60 >XP_006437455.1 hypothetical protein CICLE_v10033474mg [Citrus clementina] ESR50695.1 hypothetical protein CICLE_v10033474mg [Citrus clementina] Length = 381 Score = 74.3 bits (181), Expect = 4e-13 Identities = 37/60 (61%), Positives = 47/60 (78%) Frame = +1 Query: 187 MSDIPAEVLGDILSRLPVKSLLRSRCVSKPFCALIDSPEFIKVQLDYSTKTNSNLTIILS 366 M+ +P ++ DILSRL VK LLR +CVSK FC+LIDS EFIK+ L S +TNSNL++ILS Sbjct: 1 MAGLPTDINIDILSRLSVKCLLRFKCVSKSFCSLIDSQEFIKIHLKRSIETNSNLSLILS 60 >XP_006424213.1 hypothetical protein CICLE_v10028697mg [Citrus clementina] ESR37453.1 hypothetical protein CICLE_v10028697mg [Citrus clementina] KDO58128.1 hypothetical protein CISIN_1g017755mg [Citrus sinensis] Length = 366 Score = 73.9 bits (180), Expect = 5e-13 Identities = 34/59 (57%), Positives = 47/59 (79%) Frame = +1 Query: 187 MSDIPAEVLGDILSRLPVKSLLRSRCVSKPFCALIDSPEFIKVQLDYSTKTNSNLTIIL 363 MS +P +++ DILSRLPVK LLR RCVSK FC LIDS +F+K+ L+ + +TNS L++I+ Sbjct: 1 MSSLPLDLISDILSRLPVKPLLRFRCVSKCFCGLIDSQDFVKLHLNQAIETNSGLSLIV 59 >OMP08780.1 hypothetical protein COLO4_06128 [Corchorus olitorius] Length = 321 Score = 73.2 bits (178), Expect = 8e-13 Identities = 35/58 (60%), Positives = 46/58 (79%) Frame = +1 Query: 190 SDIPAEVLGDILSRLPVKSLLRSRCVSKPFCALIDSPEFIKVQLDYSTKTNSNLTIIL 363 S IP +++ DIL RLPV+ LLR R VSKP+C+LIDSP FIK+ L +S KT +NL++IL Sbjct: 3 SIIPLDIITDILCRLPVEELLRFRSVSKPWCSLIDSPNFIKLHLSHSLKTQTNLSLIL 60 >CDP03320.1 unnamed protein product [Coffea canephora] Length = 389 Score = 73.6 bits (179), Expect = 8e-13 Identities = 37/56 (66%), Positives = 45/56 (80%) Frame = +1 Query: 196 IPAEVLGDILSRLPVKSLLRSRCVSKPFCALIDSPEFIKVQLDYSTKTNSNLTIIL 363 IPAEV+ +L+ LPVKSLLR +CVSKP+ ALIDSP+FIK + S KTN NLT+IL Sbjct: 8 IPAEVISYLLTFLPVKSLLRFKCVSKPWLALIDSPDFIKNHISRSLKTNRNLTLIL 63 >EEF29664.1 conserved hypothetical protein [Ricinus communis] Length = 395 Score = 73.6 bits (179), Expect = 8e-13 Identities = 35/59 (59%), Positives = 45/59 (76%) Frame = +1 Query: 187 MSDIPAEVLGDILSRLPVKSLLRSRCVSKPFCALIDSPEFIKVQLDYSTKTNSNLTIIL 363 MS IP +++ D+L LPVK+LLR RC+SKP C+LIDSP+FI L +S KT SNL +IL Sbjct: 1 MSKIPDDIVSDVLLLLPVKALLRFRCLSKPLCSLIDSPDFIDHHLSHSLKTRSNLFLIL 59 >XP_002532715.2 PREDICTED: F-box protein CPR30 [Ricinus communis] Length = 407 Score = 73.6 bits (179), Expect = 8e-13 Identities = 35/59 (59%), Positives = 45/59 (76%) Frame = +1 Query: 187 MSDIPAEVLGDILSRLPVKSLLRSRCVSKPFCALIDSPEFIKVQLDYSTKTNSNLTIIL 363 MS IP +++ D+L LPVK+LLR RC+SKP C+LIDSP+FI L +S KT SNL +IL Sbjct: 1 MSKIPDDIVSDVLLLLPVKALLRFRCLSKPLCSLIDSPDFIDHHLSHSLKTRSNLFLIL 59 >XP_019155681.1 PREDICTED: F-box protein CPR30-like isoform X1 [Ipomoea nil] XP_019155682.1 PREDICTED: F-box protein CPR30-like isoform X1 [Ipomoea nil] XP_019155683.1 PREDICTED: F-box protein CPR30-like isoform X1 [Ipomoea nil] XP_019155684.1 PREDICTED: F-box protein CPR30-like isoform X1 [Ipomoea nil] Length = 430 Score = 73.2 bits (178), Expect = 1e-12 Identities = 34/66 (51%), Positives = 51/66 (77%) Frame = +1 Query: 172 IINPTMSDIPAEVLGDILSRLPVKSLLRSRCVSKPFCALIDSPEFIKVQLDYSTKTNSNL 351 +++PTMSDIP E++ + LSR+P + LLR RCVSK + +IDSP+FIK+ L+ + +TNS+ Sbjct: 27 LLHPTMSDIPLEIVTEFLSRVPARPLLRLRCVSKSWREIIDSPDFIKLHLNRALQTNSDR 86 Query: 352 TIILSS 369 +IL S Sbjct: 87 KLILPS 92 >XP_011096147.1 PREDICTED: uncharacterized protein LOC105175410 [Sesamum indicum] Length = 824 Score = 73.2 bits (178), Expect = 1e-12 Identities = 35/52 (67%), Positives = 44/52 (84%) Frame = +1 Query: 193 DIPAEVLGDILSRLPVKSLLRSRCVSKPFCALIDSPEFIKVQLDYSTKTNSN 348 ++P E++ DILSRLPVKSLLR RCVSKP+ +LIDS +F+K+ L STKTNSN Sbjct: 11 NLPQEIVTDILSRLPVKSLLRFRCVSKPWRSLIDSKDFVKLHLHQSTKTNSN 62 Score = 59.3 bits (142), Expect = 9e-08 Identities = 31/63 (49%), Positives = 42/63 (66%) Frame = +1 Query: 187 MSDIPAEVLGDILSRLPVKSLLRSRCVSKPFCALIDSPEFIKVQLDYSTKTNSNLTIILS 366 M +P E++ DIL RLPVK+L R R V+K +C LIDS FIK+ L S +NS+ ++IL Sbjct: 443 MPTLPFEIIEDILRRLPVKTLKRFRAVTKTWCFLIDSENFIKLHLRQSLVSNSHRSLILG 502 Query: 367 SGG 375 G Sbjct: 503 GLG 505 >XP_016693318.1 PREDICTED: F-box protein CPR30-like [Gossypium hirsutum] XP_016693319.1 PREDICTED: F-box protein CPR30-like [Gossypium hirsutum] XP_016693320.1 PREDICTED: F-box protein CPR30-like [Gossypium hirsutum] XP_016693321.1 PREDICTED: F-box protein CPR30-like [Gossypium hirsutum] XP_016693322.1 PREDICTED: F-box protein CPR30-like [Gossypium hirsutum] Length = 405 Score = 72.8 bits (177), Expect = 2e-12 Identities = 35/59 (59%), Positives = 43/59 (72%) Frame = +1 Query: 187 MSDIPAEVLGDILSRLPVKSLLRSRCVSKPFCALIDSPEFIKVQLDYSTKTNSNLTIIL 363 MS +P +V+ DI RLPVK+LLR R +SKP+C+LID P+F LD S KT SNL IIL Sbjct: 1 MSKVPMDVVTDIFHRLPVKTLLRFRSLSKPYCSLIDDPDFTNAHLDRSIKTRSNLNIIL 59