BLASTX nr result
ID: Panax24_contig00016070
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00016070 (559 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EPS57816.1 hypothetical protein M569_17001 [Genlisea aurea] 63 2e-08 XP_006482536.1 PREDICTED: mitochondrial outer membrane protein p... 62 4e-08 XP_006431074.1 hypothetical protein CICLE_v10012445mg [Citrus cl... 62 4e-08 XP_012841390.1 PREDICTED: mitochondrial outer membrane protein p... 61 6e-08 XP_018854999.1 PREDICTED: mitochondrial outer membrane protein p... 59 7e-08 XP_012082894.1 PREDICTED: mitochondrial outer membrane protein p... 61 8e-08 XP_016690478.1 PREDICTED: mitochondrial outer membrane protein p... 61 8e-08 KJB30164.1 hypothetical protein B456_005G132100 [Gossypium raimo... 61 1e-07 AAL04449.1 voltage-dependent anion channel, partial [Beta vulgaris] 57 1e-07 XP_011005064.1 PREDICTED: mitochondrial outer membrane protein p... 60 1e-07 XP_002324035.1 hypothetical protein POPTR_0017s11430g [Populus t... 60 1e-07 XP_010256458.1 PREDICTED: mitochondrial outer membrane protein p... 60 1e-07 XP_012478529.1 PREDICTED: mitochondrial outer membrane protein p... 59 2e-07 XP_019162196.1 PREDICTED: mitochondrial outer membrane protein p... 57 3e-07 KCW56275.1 hypothetical protein EUGRSUZ_I02018 [Eucalyptus grandis] 59 3e-07 XP_007032450.2 PREDICTED: mitochondrial outer membrane protein p... 59 4e-07 XP_010087805.1 Mitochondrial outer membrane protein porin of 34 ... 59 4e-07 XP_011098570.1 PREDICTED: mitochondrial outer membrane protein p... 59 4e-07 XP_010029375.1 PREDICTED: mitochondrial outer membrane protein p... 59 4e-07 EOY03376.1 Voltage dependent anion channel 1 [Theobroma cacao] 59 4e-07 >EPS57816.1 hypothetical protein M569_17001 [Genlisea aurea] Length = 276 Score = 62.8 bits (151), Expect = 2e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 469 LFTTITVDEPAPGLKTILSFKVPDQRSGKL 558 LFTTITVDEPAPGLKTILSFKVPDQRSGKL Sbjct: 77 LFTTITVDEPAPGLKTILSFKVPDQRSGKL 106 >XP_006482536.1 PREDICTED: mitochondrial outer membrane protein porin of 34 kDa [Citrus sinensis] Length = 274 Score = 61.6 bits (148), Expect = 4e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 469 LFTTITVDEPAPGLKTILSFKVPDQRSGKL 558 LFTTITVDEPAPGLKTILSFKVPDQRSGK+ Sbjct: 77 LFTTITVDEPAPGLKTILSFKVPDQRSGKV 106 >XP_006431074.1 hypothetical protein CICLE_v10012445mg [Citrus clementina] ESR44314.1 hypothetical protein CICLE_v10012445mg [Citrus clementina] KDO72482.1 hypothetical protein CISIN_1g023969mg [Citrus sinensis] KDO72483.1 hypothetical protein CISIN_1g023969mg [Citrus sinensis] Length = 274 Score = 61.6 bits (148), Expect = 4e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 469 LFTTITVDEPAPGLKTILSFKVPDQRSGKL 558 LFTTITVDEPAPGLKTILSFKVPDQRSGK+ Sbjct: 77 LFTTITVDEPAPGLKTILSFKVPDQRSGKV 106 >XP_012841390.1 PREDICTED: mitochondrial outer membrane protein porin of 34 kDa [Erythranthe guttata] EYU34113.1 hypothetical protein MIMGU_mgv1a011597mg [Erythranthe guttata] Length = 276 Score = 61.2 bits (147), Expect = 6e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 469 LFTTITVDEPAPGLKTILSFKVPDQRSGKL 558 LFTT+T+DEPAPGLKTI+SFKVPDQRSGKL Sbjct: 77 LFTTVTIDEPAPGLKTIISFKVPDQRSGKL 106 >XP_018854999.1 PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like [Juglans regia] Length = 123 Score = 58.5 bits (140), Expect = 7e-08 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = +1 Query: 421 LLYFSLIITDLFEQHQLFTTITVDEPAPGLKTILSFKVPDQRSGKL 558 LL +T QL TTIT+DEPAPG+KTI+SF+VPDQRSGK+ Sbjct: 9 LLQCVYFVTKSLYYDQLLTTITIDEPAPGVKTIVSFRVPDQRSGKV 54 >XP_012082894.1 PREDICTED: mitochondrial outer membrane protein porin of 34 kDa [Jatropha curcas] KDP45473.1 hypothetical protein JCGZ_09722 [Jatropha curcas] Length = 274 Score = 60.8 bits (146), Expect = 8e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 469 LFTTITVDEPAPGLKTILSFKVPDQRSGKL 558 LFTTITVDEPAPGLK ILSFKVPDQRSGKL Sbjct: 77 LFTTITVDEPAPGLKAILSFKVPDQRSGKL 106 >XP_016690478.1 PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like [Gossypium hirsutum] Length = 275 Score = 60.8 bits (146), Expect = 8e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 466 QLFTTITVDEPAPGLKTILSFKVPDQRSGKL 558 QLFTTITVDEPAPGLKTI FKVPDQRSGK+ Sbjct: 71 QLFTTITVDEPAPGLKTIFGFKVPDQRSGKI 101 >KJB30164.1 hypothetical protein B456_005G132100 [Gossypium raimondii] Length = 335 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 466 QLFTTITVDEPAPGLKTILSFKVPDQRSGKL 558 QLFTTITVDEPAPGLKTI FKVPDQRSGK+ Sbjct: 131 QLFTTITVDEPAPGLKTIFGFKVPDQRSGKI 161 >AAL04449.1 voltage-dependent anion channel, partial [Beta vulgaris] Length = 91 Score = 57.0 bits (136), Expect = 1e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 469 LFTTITVDEPAPGLKTILSFKVPDQRSGKL 558 LFTTITVDEPAPGLK I SF+VPDQRSGK+ Sbjct: 38 LFTTITVDEPAPGLKAIFSFRVPDQRSGKV 67 >XP_011005064.1 PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like [Populus euphratica] Length = 274 Score = 60.1 bits (144), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 469 LFTTITVDEPAPGLKTILSFKVPDQRSGKL 558 LFTTITVDEPAPGLKTI SFKVPDQRSGK+ Sbjct: 77 LFTTITVDEPAPGLKTIFSFKVPDQRSGKV 106 >XP_002324035.1 hypothetical protein POPTR_0017s11430g [Populus trichocarpa] ABK94151.1 unknown [Populus trichocarpa] EEF04168.1 hypothetical protein POPTR_0017s11430g [Populus trichocarpa] Length = 274 Score = 60.1 bits (144), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 469 LFTTITVDEPAPGLKTILSFKVPDQRSGKL 558 LFTTITVDEPAPGLKTI SFKVPDQRSGK+ Sbjct: 77 LFTTITVDEPAPGLKTIFSFKVPDQRSGKV 106 >XP_010256458.1 PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like [Nelumbo nucifera] Length = 276 Score = 60.1 bits (144), Expect = 1e-07 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +1 Query: 469 LFTTITVDEPAPGLKTILSFKVPDQRSGK 555 +FTTITVDEPAPGLKTILSFKVPDQRSGK Sbjct: 77 VFTTITVDEPAPGLKTILSFKVPDQRSGK 105 >XP_012478529.1 PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like [Gossypium raimondii] Length = 231 Score = 59.3 bits (142), Expect = 2e-07 Identities = 31/47 (65%), Positives = 34/47 (72%), Gaps = 2/47 (4%) Frame = +1 Query: 424 LYFSLIITDLF--EQHQLFTTITVDEPAPGLKTILSFKVPDQRSGKL 558 L F + TD+ LFTTITVDEPAPGLKTI FKVPDQRSGK+ Sbjct: 15 LKFRNVTTDIKVDTSSNLFTTITVDEPAPGLKTIFGFKVPDQRSGKI 61 >XP_019162196.1 PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like, partial [Ipomoea nil] Length = 126 Score = 57.0 bits (136), Expect = 3e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 469 LFTTITVDEPAPGLKTILSFKVPDQRSGKL 558 LFTTITV+EP PGLKTIL+F+VPDQRSGKL Sbjct: 69 LFTTITVNEPVPGLKTILNFRVPDQRSGKL 98 >KCW56275.1 hypothetical protein EUGRSUZ_I02018 [Eucalyptus grandis] Length = 260 Score = 58.9 bits (141), Expect = 3e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 469 LFTTITVDEPAPGLKTILSFKVPDQRSGKL 558 LFTTITVDEPAPGLK+I SFKVPDQRSGK+ Sbjct: 61 LFTTITVDEPAPGLKSIFSFKVPDQRSGKI 90 >XP_007032450.2 PREDICTED: mitochondrial outer membrane protein porin of 34 kDa [Theobroma cacao] Length = 276 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 469 LFTTITVDEPAPGLKTILSFKVPDQRSGKL 558 LFTTITVDEPAPGLKTI SF+VPDQRSGK+ Sbjct: 77 LFTTITVDEPAPGLKTIFSFRVPDQRSGKV 106 >XP_010087805.1 Mitochondrial outer membrane protein porin of 34 kDa [Morus notabilis] EXB30112.1 Mitochondrial outer membrane protein porin of 34 kDa [Morus notabilis] Length = 276 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +1 Query: 469 LFTTITVDEPAPGLKTILSFKVPDQRSGKL 558 LFTT+TVDEPAPGLKTILSF++PDQRSGK+ Sbjct: 77 LFTTVTVDEPAPGLKTILSFRLPDQRSGKV 106 >XP_011098570.1 PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like [Sesamum indicum] Length = 276 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 469 LFTTITVDEPAPGLKTILSFKVPDQRSGKL 558 L TT+TVDEPAPGLKTILSF+VPDQRSGKL Sbjct: 77 LLTTVTVDEPAPGLKTILSFRVPDQRSGKL 106 >XP_010029375.1 PREDICTED: mitochondrial outer membrane protein porin of 34 kDa [Eucalyptus grandis] KCW56274.1 hypothetical protein EUGRSUZ_I02018 [Eucalyptus grandis] Length = 276 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 469 LFTTITVDEPAPGLKTILSFKVPDQRSGKL 558 LFTTITVDEPAPGLK+I SFKVPDQRSGK+ Sbjct: 77 LFTTITVDEPAPGLKSIFSFKVPDQRSGKI 106 >EOY03376.1 Voltage dependent anion channel 1 [Theobroma cacao] Length = 276 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 469 LFTTITVDEPAPGLKTILSFKVPDQRSGKL 558 LFTTITVDEPAPGLKTI SF+VPDQRSGK+ Sbjct: 77 LFTTITVDEPAPGLKTIFSFRVPDQRSGKV 106