BLASTX nr result
ID: Panax24_contig00015973
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00015973 (623 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EEF42761.1 conserved hypothetical protein [Ricinus communis] 65 4e-10 >EEF42761.1 conserved hypothetical protein [Ricinus communis] Length = 140 Score = 65.5 bits (158), Expect = 4e-10 Identities = 32/58 (55%), Positives = 42/58 (72%) Frame = -1 Query: 623 DVDEMQEEAMDFDDFSFVEDGV*QENDVDDAFEVSLGEIQSLNREDMDPEDVEELVIS 450 DVDE+Q+EAMD +D + VED V QEN+++D V L EI SLNR D+D +DV +IS Sbjct: 47 DVDEIQDEAMDLNDLALVEDEVYQENEINDIVIVDLSEIASLNRVDIDLKDVNSFIIS 104