BLASTX nr result
ID: Panax24_contig00015892
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00015892 (1136 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010654944.1 PREDICTED: pyrophosphate-energized vacuolar membr... 123 6e-31 JAU33916.1 Pyrophosphate-energized vacuolar membrane proton pump... 118 1e-29 JAU64016.1 Pyrophosphate-energized vacuolar membrane proton pump... 118 1e-29 EAY84758.1 hypothetical protein OsI_06126 [Oryza sativa Indica G... 121 2e-28 XP_010419389.1 PREDICTED: pyrophosphate-energized vacuolar membr... 117 2e-28 ABK94904.1 unknown [Populus trichocarpa] 121 3e-28 OIT33043.1 pyrophosphate-energized vacuolar membrane proton pump... 118 3e-28 BAS77331.1 Os02g0184200, partial [Oryza sativa Japonica Group] 121 4e-28 CBI36400.3 unnamed protein product, partial [Vitis vinifera] 123 5e-28 BAD94555.1 hypothetical protein [Arabidopsis thaliana] 117 6e-28 BAF95863.1 H+-pyrophosphatase, partial [Vitis hybrid cultivar] 116 8e-28 BAF08021.2 Os02g0184200, partial [Oryza sativa Japonica Group] 121 1e-27 ONK60265.1 uncharacterized protein A4U43_C08F16220 [Asparagus of... 123 5e-27 ABO45933.1 vacuolar H+-pyrophosphatase [Halostachys caspica] 123 5e-27 KNA10816.1 hypothetical protein SOVF_140670 [Spinacia oleracea] 123 5e-27 XP_010097004.1 Pyrophosphate-energized vacuolar membrane proton ... 123 5e-27 AOE45990.1 pyrophosphate-energized vacuolar membrane proton pump... 123 5e-27 NP_001312147.1 pyrophosphate-energized vacuolar membrane proton ... 123 5e-27 XP_011073387.1 PREDICTED: pyrophosphate-energized vacuolar membr... 123 5e-27 XP_010913343.1 PREDICTED: pyrophosphate-energized vacuolar membr... 123 5e-27 >XP_010654944.1 PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like [Vitis vinifera] Length = 111 Score = 123 bits (308), Expect = 6e-31 Identities = 60/60 (100%), Positives = 60/60 (100%) Frame = -3 Query: 1134 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 955 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 52 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 111 >JAU33916.1 Pyrophosphate-energized vacuolar membrane proton pump, partial [Noccaea caerulescens] Length = 77 Score = 118 bits (296), Expect = 1e-29 Identities = 57/60 (95%), Positives = 59/60 (98%) Frame = -3 Query: 1134 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 955 +LGPKGS+PHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGG LFKIF Sbjct: 17 SLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGFLFKIF 76 >JAU64016.1 Pyrophosphate-energized vacuolar membrane proton pump, partial [Noccaea caerulescens] Length = 81 Score = 118 bits (296), Expect = 1e-29 Identities = 57/60 (95%), Positives = 59/60 (98%) Frame = -3 Query: 1134 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 955 +LGPKGS+PHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGG LFKIF Sbjct: 21 SLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGFLFKIF 80 >EAY84758.1 hypothetical protein OsI_06126 [Oryza sativa Indica Group] Length = 268 Score = 121 bits (304), Expect = 2e-28 Identities = 58/60 (96%), Positives = 60/60 (100%) Frame = -3 Query: 1134 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 955 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGG+LFK+F Sbjct: 209 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGILFKLF 268 >XP_010419389.1 PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 1-like, partial [Camelina sativa] Length = 141 Score = 117 bits (293), Expect = 2e-28 Identities = 56/60 (93%), Positives = 59/60 (98%) Frame = -3 Query: 1134 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 955 +LGPKGS+PHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGG LF+IF Sbjct: 81 SLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGFLFRIF 140 >ABK94904.1 unknown [Populus trichocarpa] Length = 288 Score = 121 bits (304), Expect = 3e-28 Identities = 59/60 (98%), Positives = 60/60 (100%) Frame = -3 Query: 1134 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 955 +LGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 229 SLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 288 >OIT33043.1 pyrophosphate-energized vacuolar membrane proton pump [Nicotiana attenuata] Length = 183 Score = 118 bits (296), Expect = 3e-28 Identities = 56/60 (93%), Positives = 59/60 (98%) Frame = -3 Query: 1134 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 955 TLGPKGSD HKAAVIGDT+GDPLKDTSGPSLNILIKLMA+ESLVFAPFFATHGGLLFK+F Sbjct: 124 TLGPKGSDAHKAAVIGDTVGDPLKDTSGPSLNILIKLMAIESLVFAPFFATHGGLLFKLF 183 >BAS77331.1 Os02g0184200, partial [Oryza sativa Japonica Group] Length = 314 Score = 121 bits (304), Expect = 4e-28 Identities = 58/60 (96%), Positives = 60/60 (100%) Frame = -3 Query: 1134 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 955 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGG+LFK+F Sbjct: 255 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGILFKLF 314 >CBI36400.3 unnamed protein product, partial [Vitis vinifera] Length = 395 Score = 123 bits (308), Expect = 5e-28 Identities = 60/60 (100%), Positives = 60/60 (100%) Frame = -3 Query: 1134 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 955 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 336 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 395 >BAD94555.1 hypothetical protein [Arabidopsis thaliana] Length = 173 Score = 117 bits (293), Expect = 6e-28 Identities = 56/60 (93%), Positives = 59/60 (98%) Frame = -3 Query: 1134 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 955 +LGPKGS+PHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGG+LFK F Sbjct: 114 SLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGILFKYF 173 >BAF95863.1 H+-pyrophosphatase, partial [Vitis hybrid cultivar] Length = 161 Score = 116 bits (291), Expect = 8e-28 Identities = 56/59 (94%), Positives = 58/59 (98%) Frame = -3 Query: 1134 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKI 958 +LGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFA HGGLLFK+ Sbjct: 102 SLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFAAHGGLLFKL 160 >BAF08021.2 Os02g0184200, partial [Oryza sativa Japonica Group] Length = 360 Score = 121 bits (304), Expect = 1e-27 Identities = 58/60 (96%), Positives = 60/60 (100%) Frame = -3 Query: 1134 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 955 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGG+LFK+F Sbjct: 301 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGILFKLF 360 >ONK60265.1 uncharacterized protein A4U43_C08F16220 [Asparagus officinalis] Length = 667 Score = 123 bits (308), Expect = 5e-27 Identities = 60/60 (100%), Positives = 60/60 (100%) Frame = -3 Query: 1134 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 955 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 608 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 667 >ABO45933.1 vacuolar H+-pyrophosphatase [Halostachys caspica] Length = 764 Score = 123 bits (308), Expect = 5e-27 Identities = 60/60 (100%), Positives = 60/60 (100%) Frame = -3 Query: 1134 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 955 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 705 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 764 >KNA10816.1 hypothetical protein SOVF_140670 [Spinacia oleracea] Length = 764 Score = 123 bits (308), Expect = 5e-27 Identities = 60/60 (100%), Positives = 60/60 (100%) Frame = -3 Query: 1134 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 955 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 703 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 762 >XP_010097004.1 Pyrophosphate-energized vacuolar membrane proton pump [Morus notabilis] EXB66631.1 Pyrophosphate-energized vacuolar membrane proton pump [Morus notabilis] Length = 764 Score = 123 bits (308), Expect = 5e-27 Identities = 60/60 (100%), Positives = 60/60 (100%) Frame = -3 Query: 1134 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 955 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 705 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 764 >AOE45990.1 pyrophosphate-energized vacuolar membrane proton pump [Hibiscus cannabinus] Length = 765 Score = 123 bits (308), Expect = 5e-27 Identities = 60/60 (100%), Positives = 60/60 (100%) Frame = -3 Query: 1134 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 955 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 705 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 764 >NP_001312147.1 pyrophosphate-energized vacuolar membrane proton pump-like [Nicotiana tabacum] CAA58701.1 inorganic pyrophosphatase [Nicotiana tabacum] Length = 765 Score = 123 bits (308), Expect = 5e-27 Identities = 60/60 (100%), Positives = 60/60 (100%) Frame = -3 Query: 1134 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 955 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 706 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 765 >XP_011073387.1 PREDICTED: pyrophosphate-energized vacuolar membrane proton pump [Sesamum indicum] Length = 765 Score = 123 bits (308), Expect = 5e-27 Identities = 60/60 (100%), Positives = 60/60 (100%) Frame = -3 Query: 1134 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 955 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 706 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 765 >XP_010913343.1 PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like [Elaeis guineensis] Length = 765 Score = 123 bits (308), Expect = 5e-27 Identities = 60/60 (100%), Positives = 60/60 (100%) Frame = -3 Query: 1134 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 955 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 706 TLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 765