BLASTX nr result
ID: Panax24_contig00015491
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00015491 (355 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012068683.1 PREDICTED: NADH dehydrogenase [ubiquinone] 1 alph... 51 1e-05 >XP_012068683.1 PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 [Jatropha curcas] KDP40546.1 hypothetical protein JCGZ_24545 [Jatropha curcas] Length = 132 Score = 51.2 bits (121), Expect = 1e-05 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 1/30 (3%) Frame = -2 Query: 354 VGQHGLVQDLGS-DEGNSDFLKNFYKTNYF 268 VGQHGLVQDL S D+G SDFLKNFYK+NY+ Sbjct: 103 VGQHGLVQDLDSKDQGMSDFLKNFYKSNYY 132