BLASTX nr result
ID: Panax24_contig00015241
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00015241 (577 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM96187.1 hypothetical protein DCAR_019429 [Daucus carota subsp... 99 1e-20 XP_017252966.1 PREDICTED: protein transport protein Sec24-like A... 99 1e-20 CBI20238.3 unnamed protein product, partial [Vitis vinifera] 95 3e-19 KVI11615.1 Sec23/Sec24 beta-sandwich [Cynara cardunculus var. sc... 95 3e-19 XP_002282857.1 PREDICTED: protein transport protein Sec24-like A... 95 3e-19 XP_017227947.1 PREDICTED: protein transport protein Sec24-like A... 94 6e-19 KZN10042.1 hypothetical protein DCAR_002698 [Daucus carota subsp... 94 6e-19 XP_019163964.1 PREDICTED: protein transport protein Sec24-like A... 93 2e-18 XP_010696478.1 PREDICTED: protein transport protein Sec24-like A... 92 3e-18 XP_010052183.1 PREDICTED: protein transport protein Sec24-like A... 91 1e-17 KDO62239.1 hypothetical protein CISIN_1g0017201mg, partial [Citr... 90 1e-17 XP_006452538.1 hypothetical protein CICLE_v10007324mg [Citrus cl... 90 1e-17 XP_008450519.1 PREDICTED: protein transport protein Sec24-like A... 90 2e-17 XP_009335526.1 PREDICTED: protein transport protein Sec24-like A... 89 4e-17 XP_008388437.1 PREDICTED: protein transport protein Sec24-like A... 89 4e-17 XP_004135758.1 PREDICTED: protein transport protein Sec24-like A... 89 5e-17 KZV30407.1 protein transport protein Sec24-like [Dorcoceras hygr... 88 9e-17 XP_008246292.1 PREDICTED: protein transport protein Sec24-like A... 87 1e-16 XP_007208425.1 hypothetical protein PRUPE_ppa000637mg [Prunus pe... 87 1e-16 KNA11292.1 hypothetical protein SOVF_136540 [Spinacia oleracea] 87 2e-16 >KZM96187.1 hypothetical protein DCAR_019429 [Daucus carota subsp. sativus] Length = 995 Score = 99.0 bits (245), Expect = 1e-20 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -1 Query: 577 PSYYQLCHLVRQGEQPREGFFILANLVEDQVGGMNGYVDWIQQIHR 440 PSYYQ CHLVRQGEQPREGFF+LANLVEDQVGGMNGYVDWIQQIHR Sbjct: 944 PSYYQSCHLVRQGEQPREGFFMLANLVEDQVGGMNGYVDWIQQIHR 989 >XP_017252966.1 PREDICTED: protein transport protein Sec24-like At3g07100 [Daucus carota subsp. sativus] Length = 1065 Score = 99.0 bits (245), Expect = 1e-20 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -1 Query: 577 PSYYQLCHLVRQGEQPREGFFILANLVEDQVGGMNGYVDWIQQIHR 440 PSYYQ CHLVRQGEQPREGFF+LANLVEDQVGGMNGYVDWIQQIHR Sbjct: 1014 PSYYQSCHLVRQGEQPREGFFMLANLVEDQVGGMNGYVDWIQQIHR 1059 >CBI20238.3 unnamed protein product, partial [Vitis vinifera] Length = 944 Score = 94.7 bits (234), Expect = 3e-19 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -1 Query: 577 PSYYQLCHLVRQGEQPREGFFILANLVEDQVGGMNGYVDWIQQIHR 440 PSYYQLCHLVRQGEQPREGFF+LANLVEDQ+GG NGY DWI QIHR Sbjct: 893 PSYYQLCHLVRQGEQPREGFFLLANLVEDQIGGTNGYADWILQIHR 938 >KVI11615.1 Sec23/Sec24 beta-sandwich [Cynara cardunculus var. scolymus] Length = 972 Score = 94.7 bits (234), Expect = 3e-19 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -1 Query: 577 PSYYQLCHLVRQGEQPREGFFILANLVEDQVGGMNGYVDWIQQIHR 440 PSYYQLCHLVRQGEQPREGFF+L NLVEDQVGGMNGY DW+ QIHR Sbjct: 923 PSYYQLCHLVRQGEQPREGFFLLLNLVEDQVGGMNGYADWLLQIHR 968 >XP_002282857.1 PREDICTED: protein transport protein Sec24-like At3g07100 [Vitis vinifera] XP_010644160.1 PREDICTED: protein transport protein Sec24-like At3g07100 [Vitis vinifera] XP_010644162.1 PREDICTED: protein transport protein Sec24-like At3g07100 [Vitis vinifera] XP_010644163.1 PREDICTED: protein transport protein Sec24-like At3g07100 [Vitis vinifera] Length = 1052 Score = 94.7 bits (234), Expect = 3e-19 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -1 Query: 577 PSYYQLCHLVRQGEQPREGFFILANLVEDQVGGMNGYVDWIQQIHR 440 PSYYQLCHLVRQGEQPREGFF+LANLVEDQ+GG NGY DWI QIHR Sbjct: 1001 PSYYQLCHLVRQGEQPREGFFLLANLVEDQIGGTNGYADWILQIHR 1046 >XP_017227947.1 PREDICTED: protein transport protein Sec24-like At3g07100 [Daucus carota subsp. sativus] XP_017227951.1 PREDICTED: protein transport protein Sec24-like At3g07100 [Daucus carota subsp. sativus] Length = 1021 Score = 94.0 bits (232), Expect = 6e-19 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -1 Query: 577 PSYYQLCHLVRQGEQPREGFFILANLVEDQVGGMNGYVDWIQQIHR 440 PSYYQLCHLVRQGEQPREGFF+L NLVEDQVGGMN Y+DWI QIHR Sbjct: 970 PSYYQLCHLVRQGEQPREGFFLLVNLVEDQVGGMNSYLDWILQIHR 1015 >KZN10042.1 hypothetical protein DCAR_002698 [Daucus carota subsp. sativus] Length = 1023 Score = 94.0 bits (232), Expect = 6e-19 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -1 Query: 577 PSYYQLCHLVRQGEQPREGFFILANLVEDQVGGMNGYVDWIQQIHR 440 PSYYQLCHLVRQGEQPREGFF+L NLVEDQVGGMN Y+DWI QIHR Sbjct: 972 PSYYQLCHLVRQGEQPREGFFLLVNLVEDQVGGMNSYLDWILQIHR 1017 >XP_019163964.1 PREDICTED: protein transport protein Sec24-like At3g07100 [Ipomoea nil] XP_019163965.1 PREDICTED: protein transport protein Sec24-like At3g07100 [Ipomoea nil] Length = 998 Score = 92.8 bits (229), Expect = 2e-18 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -1 Query: 577 PSYYQLCHLVRQGEQPREGFFILANLVEDQVGGMNGYVDWIQQIHR 440 PSYYQLCHLVRQGEQPREGFF+L NLVEDQVGG NGY+DWI Q+HR Sbjct: 947 PSYYQLCHLVRQGEQPREGFFLLRNLVEDQVGGTNGYMDWIVQLHR 992 >XP_010696478.1 PREDICTED: protein transport protein Sec24-like At3g07100 [Beta vulgaris subsp. vulgaris] XP_010696482.1 PREDICTED: protein transport protein Sec24-like At3g07100 [Beta vulgaris subsp. vulgaris] XP_010696486.1 PREDICTED: protein transport protein Sec24-like At3g07100 [Beta vulgaris subsp. vulgaris] KMT18963.1 hypothetical protein BVRB_2g030610 [Beta vulgaris subsp. vulgaris] Length = 1088 Score = 92.0 bits (227), Expect = 3e-18 Identities = 38/46 (82%), Positives = 44/46 (95%) Frame = -1 Query: 577 PSYYQLCHLVRQGEQPREGFFILANLVEDQVGGMNGYVDWIQQIHR 440 P+YYQLCHLVRQGEQPREGF++LANL+EDQ GG++GYVDWI QIHR Sbjct: 1037 PAYYQLCHLVRQGEQPREGFYLLANLIEDQTGGISGYVDWISQIHR 1082 >XP_010052183.1 PREDICTED: protein transport protein Sec24-like At3g07100 [Eucalyptus grandis] XP_010052184.1 PREDICTED: protein transport protein Sec24-like At3g07100 [Eucalyptus grandis] XP_010052185.1 PREDICTED: protein transport protein Sec24-like At3g07100 [Eucalyptus grandis] KCW76104.1 hypothetical protein EUGRSUZ_D00483 [Eucalyptus grandis] KCW76105.1 hypothetical protein EUGRSUZ_D00483 [Eucalyptus grandis] Length = 1029 Score = 90.5 bits (223), Expect = 1e-17 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = -1 Query: 577 PSYYQLCHLVRQGEQPREGFFILANLVEDQVGGMNGYVDWIQQIHR 440 PSYYQLCHLVRQGEQPREGF +LANLVEDQ+ G NGYVDW+ QIHR Sbjct: 978 PSYYQLCHLVRQGEQPREGFLLLANLVEDQMSGTNGYVDWVLQIHR 1023 >KDO62239.1 hypothetical protein CISIN_1g0017201mg, partial [Citrus sinensis] KDO62240.1 hypothetical protein CISIN_1g0017201mg, partial [Citrus sinensis] KDO62241.1 hypothetical protein CISIN_1g0017201mg, partial [Citrus sinensis] Length = 666 Score = 90.1 bits (222), Expect = 1e-17 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = -1 Query: 577 PSYYQLCHLVRQGEQPREGFFILANLVEDQVGGMNGYVDWIQQIHR 440 PSYYQLC LVRQGEQPREGF +LANLVEDQ+GG NGY DWI QIHR Sbjct: 615 PSYYQLCQLVRQGEQPREGFLLLANLVEDQIGGSNGYADWIMQIHR 660 >XP_006452538.1 hypothetical protein CICLE_v10007324mg [Citrus clementina] XP_006452539.1 hypothetical protein CICLE_v10007324mg [Citrus clementina] XP_006452540.1 hypothetical protein CICLE_v10007324mg [Citrus clementina] XP_006474934.1 PREDICTED: protein transport protein Sec24-like At3g07100 [Citrus sinensis] XP_006474935.1 PREDICTED: protein transport protein Sec24-like At3g07100 [Citrus sinensis] XP_015384684.1 PREDICTED: protein transport protein Sec24-like At3g07100 [Citrus sinensis] ESR65778.1 hypothetical protein CICLE_v10007324mg [Citrus clementina] ESR65779.1 hypothetical protein CICLE_v10007324mg [Citrus clementina] ESR65780.1 hypothetical protein CICLE_v10007324mg [Citrus clementina] Length = 1035 Score = 90.1 bits (222), Expect = 1e-17 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = -1 Query: 577 PSYYQLCHLVRQGEQPREGFFILANLVEDQVGGMNGYVDWIQQIHR 440 PSYYQLC LVRQGEQPREGF +LANLVEDQ+GG NGY DWI QIHR Sbjct: 984 PSYYQLCQLVRQGEQPREGFLLLANLVEDQIGGSNGYADWIMQIHR 1029 >XP_008450519.1 PREDICTED: protein transport protein Sec24-like At3g07100 isoform X1 [Cucumis melo] XP_016900966.1 PREDICTED: protein transport protein Sec24-like At3g07100 isoform X1 [Cucumis melo] Length = 1031 Score = 89.7 bits (221), Expect = 2e-17 Identities = 40/46 (86%), Positives = 42/46 (91%) Frame = -1 Query: 577 PSYYQLCHLVRQGEQPREGFFILANLVEDQVGGMNGYVDWIQQIHR 440 PSYYQL HLVRQGEQPREGF +LANLVEDQVGG NGYVDW+ QIHR Sbjct: 980 PSYYQLSHLVRQGEQPREGFLLLANLVEDQVGGTNGYVDWLLQIHR 1025 >XP_009335526.1 PREDICTED: protein transport protein Sec24-like At3g07100 [Pyrus x bretschneideri] XP_009335527.1 PREDICTED: protein transport protein Sec24-like At3g07100 [Pyrus x bretschneideri] Length = 1057 Score = 89.0 bits (219), Expect = 4e-17 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = -1 Query: 577 PSYYQLCHLVRQGEQPREGFFILANLVEDQVGGMNGYVDWIQQIHR 440 PSYYQLCHLVRQGEQPREG ILANLVE+Q+GG NGYVDWI Q+HR Sbjct: 1006 PSYYQLCHLVRQGEQPREGHLILANLVEEQMGGSNGYVDWIIQVHR 1051 >XP_008388437.1 PREDICTED: protein transport protein Sec24-like At3g07100 [Malus domestica] XP_017191933.1 PREDICTED: protein transport protein Sec24-like At3g07100 [Malus domestica] Length = 1057 Score = 89.0 bits (219), Expect = 4e-17 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = -1 Query: 577 PSYYQLCHLVRQGEQPREGFFILANLVEDQVGGMNGYVDWIQQIHR 440 PSYYQLCHLVRQGEQPREG ILANLVE+Q+GG NGYVDWI Q+HR Sbjct: 1006 PSYYQLCHLVRQGEQPREGHLILANLVEEQMGGSNGYVDWIIQVHR 1051 >XP_004135758.1 PREDICTED: protein transport protein Sec24-like At3g07100 [Cucumis sativus] KGN65983.1 hypothetical protein Csa_1G560670 [Cucumis sativus] Length = 1031 Score = 88.6 bits (218), Expect = 5e-17 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = -1 Query: 577 PSYYQLCHLVRQGEQPREGFFILANLVEDQVGGMNGYVDWIQQIHR 440 PSYYQL HLVRQGEQPREGF +LANLVEDQ+GG NGYVDW+ QIHR Sbjct: 980 PSYYQLSHLVRQGEQPREGFLLLANLVEDQMGGTNGYVDWLLQIHR 1025 >KZV30407.1 protein transport protein Sec24-like [Dorcoceras hygrometricum] Length = 1042 Score = 87.8 bits (216), Expect = 9e-17 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -1 Query: 577 PSYYQLCHLVRQGEQPREGFFILANLVEDQVGGMNGYVDWIQQIHR 440 PSYYQLCHLVRQGEQPREG+F+L+NLVEDQ GG +GY DW Q+HR Sbjct: 991 PSYYQLCHLVRQGEQPREGYFLLSNLVEDQAGGASGYADWFMQLHR 1036 >XP_008246292.1 PREDICTED: protein transport protein Sec24-like At3g07100 [Prunus mume] XP_008246293.1 PREDICTED: protein transport protein Sec24-like At3g07100 [Prunus mume] XP_016651888.1 PREDICTED: protein transport protein Sec24-like At3g07100 [Prunus mume] Length = 1058 Score = 87.4 bits (215), Expect = 1e-16 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = -1 Query: 574 SYYQLCHLVRQGEQPREGFFILANLVEDQVGGMNGYVDWIQQIHR 440 SYYQLCHLVRQGEQPREG +LANLVEDQ+GG NGYVDWI Q+HR Sbjct: 1008 SYYQLCHLVRQGEQPREGHLVLANLVEDQMGGTNGYVDWIIQVHR 1052 >XP_007208425.1 hypothetical protein PRUPE_ppa000637mg [Prunus persica] ONI04173.1 hypothetical protein PRUPE_6G306800 [Prunus persica] ONI04174.1 hypothetical protein PRUPE_6G306800 [Prunus persica] ONI04175.1 hypothetical protein PRUPE_6G306800 [Prunus persica] Length = 1058 Score = 87.4 bits (215), Expect = 1e-16 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = -1 Query: 574 SYYQLCHLVRQGEQPREGFFILANLVEDQVGGMNGYVDWIQQIHR 440 SYYQLCHLVRQGEQPREG +LANLVEDQ+GG NGYVDWI Q+HR Sbjct: 1008 SYYQLCHLVRQGEQPREGHLVLANLVEDQMGGTNGYVDWIIQVHR 1052 >KNA11292.1 hypothetical protein SOVF_136540 [Spinacia oleracea] Length = 995 Score = 87.0 bits (214), Expect = 2e-16 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -1 Query: 577 PSYYQLCHLVRQGEQPREGFFILANLVEDQVGGMNGYVDWIQQIHR 440 P+YYQ CHLVRQGEQP+EGF++L+NL+EDQ G NGYVDWI QIHR Sbjct: 944 PAYYQFCHLVRQGEQPKEGFYVLSNLIEDQTAGTNGYVDWIAQIHR 989