BLASTX nr result
ID: Panax24_contig00014800
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00014800 (419 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN03334.1 hypothetical protein DCAR_012090 [Daucus carota subsp... 85 9e-17 XP_008458039.1 PREDICTED: palmitoyl-acyl carrier protein thioest... 85 1e-16 XP_004139335.1 PREDICTED: palmitoyl-acyl carrier protein thioest... 85 1e-16 XP_018814380.1 PREDICTED: palmitoyl-acyl carrier protein thioest... 79 1e-16 XP_017243072.1 PREDICTED: palmitoyl-acyl carrier protein thioest... 84 3e-16 XP_011078334.1 PREDICTED: palmitoyl-acyl carrier protein thioest... 84 3e-16 KZN01685.1 hypothetical protein DCAR_010439 [Daucus carota subsp... 84 3e-16 AFK12728.1 fatB, partial [Helianthus annuus] 82 3e-16 AFK12722.1 fatB, partial [Helianthus petiolaris] 82 3e-16 AFK12721.1 fatB, partial [Helianthus petiolaris] 82 3e-16 NP_001254000.1 myristoyl-acyl carrier protein thioesterase, chlo... 84 3e-16 KVI01282.1 Acyl-ACP thioesterase [Cynara cardunculus var. scolymus] 84 4e-16 AIU99497.1 Acyl-ACP Thioesterase B [Salvia miltiorrhiza] 84 4e-16 ACQ57189.1 acyl acyl-carrier-protein thioesterase type B [Camell... 83 5e-16 AGC31686.1 chloroplast acyl-acylcarrier protein thioesterase B [... 83 5e-16 AGC31685.1 chloroplast acyl-acylcarrier protein thioesterase B [... 83 5e-16 AGC31683.1 chloroplast acyl-acylcarrier protein thioesterase B [... 83 5e-16 ACQ57190.1 acyl acyl-carrier-protein thioesterase type B, partia... 83 5e-16 ACQ63293.1 acyl acyl-carrier-protein thioesterase type B, partia... 83 5e-16 ACQ57188.1 acyl acyl-carrier-protein thioesterase type B, partia... 83 5e-16 >KZN03334.1 hypothetical protein DCAR_012090 [Daucus carota subsp. sativus] Length = 411 Score = 85.1 bits (209), Expect = 9e-17 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = +2 Query: 2 VKNAGLLGDGFGSTPEMCKRNLIWVVTKMQVMVDRYPTW 118 VK AGLLGDGFGSTPEMCKRNLIWVVTKMQVMVDRYPTW Sbjct: 166 VKTAGLLGDGFGSTPEMCKRNLIWVVTKMQVMVDRYPTW 204 >XP_008458039.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic-like [Cucumis melo] XP_008458045.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic-like [Cucumis melo] XP_008458051.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic-like [Cucumis melo] XP_008458060.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic-like [Cucumis melo] Length = 418 Score = 85.1 bits (209), Expect = 1e-16 Identities = 39/67 (58%), Positives = 50/67 (74%) Frame = +2 Query: 2 VKNAGLLGDGFGSTPEMCKRNLIWVVTKMQVMVDRYPTWLN*TTLETNDVIMVGGDDSKG 181 VK AGLLGDGFGSTPEMCK+NLIWVVTKMQ+MVDRYPTW + T++ + + G + Sbjct: 172 VKTAGLLGDGFGSTPEMCKKNLIWVVTKMQIMVDRYPTWGD--TVQVDTWVSASGKNGMR 229 Query: 182 DYWMSFN 202 W+ ++ Sbjct: 230 RDWLVYD 236 >XP_004139335.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Cucumis sativus] XP_011648667.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Cucumis sativus] XP_011648668.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Cucumis sativus] KGN60640.1 hypothetical protein Csa_2G005370 [Cucumis sativus] Length = 420 Score = 85.1 bits (209), Expect = 1e-16 Identities = 39/67 (58%), Positives = 50/67 (74%) Frame = +2 Query: 2 VKNAGLLGDGFGSTPEMCKRNLIWVVTKMQVMVDRYPTWLN*TTLETNDVIMVGGDDSKG 181 VK AGLLGDGFGSTPEMCK+NLIWVVTKMQ+MVDRYPTW + T++ + + G + Sbjct: 174 VKTAGLLGDGFGSTPEMCKKNLIWVVTKMQIMVDRYPTWGD--TVQVDTWVSASGKNGMR 231 Query: 182 DYWMSFN 202 W+ ++ Sbjct: 232 RDWLVYD 238 >XP_018814380.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic-like [Juglans regia] Length = 96 Score = 79.0 bits (193), Expect = 1e-16 Identities = 33/39 (84%), Positives = 39/39 (100%) Frame = +2 Query: 2 VKNAGLLGDGFGSTPEMCKRNLIWVVTKMQVMVDRYPTW 118 VK+AGLLGDGFGSTP+MC++NLIWVVT+MQV+VDRYPTW Sbjct: 54 VKSAGLLGDGFGSTPKMCRKNLIWVVTRMQVVVDRYPTW 92 >XP_017243072.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic-like [Daucus carota subsp. sativus] XP_017243073.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic-like [Daucus carota subsp. sativus] Length = 418 Score = 84.0 bits (206), Expect = 3e-16 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +2 Query: 2 VKNAGLLGDGFGSTPEMCKRNLIWVVTKMQVMVDRYPTW 118 VKNAGLLGDGFGSTPEMCK+ LIWVVTKMQVMVDRYPTW Sbjct: 173 VKNAGLLGDGFGSTPEMCKKKLIWVVTKMQVMVDRYPTW 211 >XP_011078334.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Sesamum indicum] XP_011078335.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Sesamum indicum] XP_011078336.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Sesamum indicum] XP_011078337.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Sesamum indicum] Length = 424 Score = 84.0 bits (206), Expect = 3e-16 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +2 Query: 2 VKNAGLLGDGFGSTPEMCKRNLIWVVTKMQVMVDRYPTW 118 VKNAGLL DGFGSTPEMCKRNLIWVVTKMQV+VDRYPTW Sbjct: 179 VKNAGLLADGFGSTPEMCKRNLIWVVTKMQVLVDRYPTW 217 >KZN01685.1 hypothetical protein DCAR_010439 [Daucus carota subsp. sativus] Length = 435 Score = 84.0 bits (206), Expect = 3e-16 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +2 Query: 2 VKNAGLLGDGFGSTPEMCKRNLIWVVTKMQVMVDRYPTW 118 VKNAGLLGDGFGSTPEMCK+ LIWVVTKMQVMVDRYPTW Sbjct: 190 VKNAGLLGDGFGSTPEMCKKKLIWVVTKMQVMVDRYPTW 228 >AFK12728.1 fatB, partial [Helianthus annuus] Length = 276 Score = 82.4 bits (202), Expect = 3e-16 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +2 Query: 2 VKNAGLLGDGFGSTPEMCKRNLIWVVTKMQVMVDRYPTW 118 VK+AGLLGDGFGSTPEMCKRNL WVVTKMQV+VDRYPTW Sbjct: 143 VKSAGLLGDGFGSTPEMCKRNLFWVVTKMQVIVDRYPTW 181 >AFK12722.1 fatB, partial [Helianthus petiolaris] Length = 276 Score = 82.4 bits (202), Expect = 3e-16 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +2 Query: 2 VKNAGLLGDGFGSTPEMCKRNLIWVVTKMQVMVDRYPTW 118 VK+AGLLGDGFGSTPEMCKRNL WVVTKMQV+VDRYPTW Sbjct: 143 VKSAGLLGDGFGSTPEMCKRNLFWVVTKMQVIVDRYPTW 181 >AFK12721.1 fatB, partial [Helianthus petiolaris] Length = 276 Score = 82.4 bits (202), Expect = 3e-16 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +2 Query: 2 VKNAGLLGDGFGSTPEMCKRNLIWVVTKMQVMVDRYPTW 118 VK+AGLLGDGFGSTPEMCKRNL WVVTKMQV+VDRYPTW Sbjct: 143 VKSAGLLGDGFGSTPEMCKRNLFWVVTKMQVIVDRYPTW 181 >NP_001254000.1 myristoyl-acyl carrier protein thioesterase, chloroplastic-like [Glycine max] XP_006600169.1 PREDICTED: myristoyl-acyl carrier protein thioesterase, chloroplastic-like isoform X1 [Glycine max] XP_006600170.1 PREDICTED: myristoyl-acyl carrier protein thioesterase, chloroplastic-like isoform X1 [Glycine max] XP_006600171.1 PREDICTED: myristoyl-acyl carrier protein thioesterase, chloroplastic-like isoform X1 [Glycine max] ACV40757.1 fatty acid biosynthesis protein [Glycine max] ADC31783.1 ACP-thioesterase protein [Glycine max] KHN10407.1 Myristoyl-acyl carrier protein thioesterase, chloroplastic [Glycine soja] KRH03792.1 hypothetical protein GLYMA_17G120400 [Glycine max] KRH03793.1 hypothetical protein GLYMA_17G120400 [Glycine max] KRH03794.1 hypothetical protein GLYMA_17G120400 [Glycine max] Length = 416 Score = 83.6 bits (205), Expect = 3e-16 Identities = 45/78 (57%), Positives = 53/78 (67%), Gaps = 3/78 (3%) Frame = +2 Query: 2 VKNAGLLGDGFGSTPEMCKRNLIWVVTKMQVMVDRYPTWLN*TTLETNDVIMVGGDDSKG 181 VK+AGLLGDGFGSTPEMCK+NLIWVVT+MQV+VDRYPTW DV+ V Sbjct: 171 VKSAGLLGDGFGSTPEMCKKNLIWVVTRMQVVVDRYPTW--------GDVVQV------- 215 Query: 182 DYWMS---FNVLR*DYIL 226 D W S N +R D++L Sbjct: 216 DTWASGSGKNAMRRDWVL 233 >KVI01282.1 Acyl-ACP thioesterase [Cynara cardunculus var. scolymus] Length = 422 Score = 83.6 bits (205), Expect = 4e-16 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +2 Query: 2 VKNAGLLGDGFGSTPEMCKRNLIWVVTKMQVMVDRYPTW 118 VKNAGLLGDGFGSTPEMCK+NL WVVTKMQV+VDRYPTW Sbjct: 177 VKNAGLLGDGFGSTPEMCKKNLFWVVTKMQVLVDRYPTW 215 >AIU99497.1 Acyl-ACP Thioesterase B [Salvia miltiorrhiza] Length = 422 Score = 83.6 bits (205), Expect = 4e-16 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +2 Query: 2 VKNAGLLGDGFGSTPEMCKRNLIWVVTKMQVMVDRYPTW 118 VKNAGLL DGFGSTPEMCKRNLIWVVTKMQV+VDRYPTW Sbjct: 177 VKNAGLLADGFGSTPEMCKRNLIWVVTKMQVVVDRYPTW 215 >ACQ57189.1 acyl acyl-carrier-protein thioesterase type B [Camellia oleifera] Length = 420 Score = 83.2 bits (204), Expect = 5e-16 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = +2 Query: 2 VKNAGLLGDGFGSTPEMCKRNLIWVVTKMQVMVDRYPTW 118 VK+AGLLGDGFGSTPEMCK+NLIWVVTKMQV+VDRYPTW Sbjct: 175 VKSAGLLGDGFGSTPEMCKKNLIWVVTKMQVLVDRYPTW 213 >AGC31686.1 chloroplast acyl-acylcarrier protein thioesterase B [Lonicera dasystyla] Length = 422 Score = 83.2 bits (204), Expect = 5e-16 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = +2 Query: 2 VKNAGLLGDGFGSTPEMCKRNLIWVVTKMQVMVDRYPTW 118 VK+AGLLGDGFG+TPEMCKRNLIWVVTKMQV+VDRYPTW Sbjct: 176 VKSAGLLGDGFGATPEMCKRNLIWVVTKMQVLVDRYPTW 214 >AGC31685.1 chloroplast acyl-acylcarrier protein thioesterase B [Lonicera hypoglauca] Length = 422 Score = 83.2 bits (204), Expect = 5e-16 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = +2 Query: 2 VKNAGLLGDGFGSTPEMCKRNLIWVVTKMQVMVDRYPTW 118 VK+AGLLGDGFG+TPEMCKRNLIWVVTKMQV+VDRYPTW Sbjct: 176 VKSAGLLGDGFGATPEMCKRNLIWVVTKMQVLVDRYPTW 214 >AGC31683.1 chloroplast acyl-acylcarrier protein thioesterase B [Lonicera japonica] AGC31684.1 chloroplast acyl-acylcarrier protein thioesterase B [Lonicera japonica var. chinensis] Length = 422 Score = 83.2 bits (204), Expect = 5e-16 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = +2 Query: 2 VKNAGLLGDGFGSTPEMCKRNLIWVVTKMQVMVDRYPTW 118 VK+AGLLGDGFG+TPEMCKRNLIWVVTKMQV+VDRYPTW Sbjct: 176 VKSAGLLGDGFGATPEMCKRNLIWVVTKMQVLVDRYPTW 214 >ACQ57190.1 acyl acyl-carrier-protein thioesterase type B, partial [Camellia oleifera] Length = 434 Score = 83.2 bits (204), Expect = 5e-16 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = +2 Query: 2 VKNAGLLGDGFGSTPEMCKRNLIWVVTKMQVMVDRYPTW 118 VK+AGLLGDGFGSTPEMCK+NLIWVVTKMQV+VDRYPTW Sbjct: 189 VKSAGLLGDGFGSTPEMCKKNLIWVVTKMQVLVDRYPTW 227 >ACQ63293.1 acyl acyl-carrier-protein thioesterase type B, partial [Camellia oleifera] Length = 434 Score = 83.2 bits (204), Expect = 5e-16 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = +2 Query: 2 VKNAGLLGDGFGSTPEMCKRNLIWVVTKMQVMVDRYPTW 118 VK+AGLLGDGFGSTPEMCK+NLIWVVTKMQV+VDRYPTW Sbjct: 189 VKSAGLLGDGFGSTPEMCKKNLIWVVTKMQVLVDRYPTW 227 >ACQ57188.1 acyl acyl-carrier-protein thioesterase type B, partial [Camellia oleifera] Length = 436 Score = 83.2 bits (204), Expect = 5e-16 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = +2 Query: 2 VKNAGLLGDGFGSTPEMCKRNLIWVVTKMQVMVDRYPTW 118 VK+AGLLGDGFGSTPEMCK+NLIWVVTKMQV+VDRYPTW Sbjct: 189 VKSAGLLGDGFGSTPEMCKKNLIWVVTKMQVLVDRYPTW 227