BLASTX nr result
ID: Panax24_contig00014747
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00014747 (555 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP11132.1 unnamed protein product [Coffea canephora] 111 2e-25 XP_002270439.2 PREDICTED: pentatricopeptide repeat-containing pr... 111 4e-25 XP_017633311.1 PREDICTED: pentatricopeptide repeat-containing pr... 110 8e-25 XP_016722344.1 PREDICTED: pentatricopeptide repeat-containing pr... 109 1e-24 XP_012481710.1 PREDICTED: pentatricopeptide repeat-containing pr... 109 2e-24 EOY05244.1 Tetratricopeptide repeat-like superfamily protein iso... 108 3e-24 XP_007034320.2 PREDICTED: pentatricopeptide repeat-containing pr... 108 3e-24 XP_016724232.1 PREDICTED: pentatricopeptide repeat-containing pr... 108 3e-24 OMO71022.1 hypothetical protein CCACVL1_18501 [Corchorus capsula... 102 3e-22 XP_019236823.1 PREDICTED: pentatricopeptide repeat-containing pr... 102 4e-22 XP_019161716.1 PREDICTED: pentatricopeptide repeat-containing pr... 102 7e-22 XP_010326841.1 PREDICTED: pentatricopeptide repeat-containing pr... 101 1e-21 XP_006360955.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 2e-21 XP_009768191.1 PREDICTED: pentatricopeptide repeat-containing pr... 99 6e-21 XP_016479905.1 PREDICTED: pentatricopeptide repeat-containing pr... 99 6e-21 XP_009610515.1 PREDICTED: pentatricopeptide repeat-containing pr... 99 6e-21 XP_010274081.1 PREDICTED: pentatricopeptide repeat-containing pr... 99 1e-20 XP_016566366.1 PREDICTED: pentatricopeptide repeat-containing pr... 97 4e-20 XP_004139010.1 PREDICTED: pentatricopeptide repeat-containing pr... 97 4e-20 OMO88605.1 hypothetical protein COLO4_20168 [Corchorus olitorius] 97 4e-20 >CDP11132.1 unnamed protein product [Coffea canephora] Length = 550 Score = 111 bits (278), Expect = 2e-25 Identities = 57/76 (75%), Positives = 61/76 (80%) Frame = -3 Query: 232 LFSSAGLIEGRAGMMVHGEILKRGLEFDSFVRVSLVDMYVKVKLLGFALQLFDESPERNK 53 L S GL + G MVHG ILK GLEFD FVRVSLVDMY K++LL ALQLFDESPERNK Sbjct: 17 LKSVVGLGDKWLGGMVHGGILKMGLEFDGFVRVSLVDMYAKMELLSLALQLFDESPERNK 76 Query: 52 LGSVLLWNVLINGCCK 5 L SVLLWNV+INGCCK Sbjct: 77 LDSVLLWNVVINGCCK 92 >XP_002270439.2 PREDICTED: pentatricopeptide repeat-containing protein At1g04840 [Vitis vinifera] Length = 677 Score = 111 bits (277), Expect = 4e-25 Identities = 54/77 (70%), Positives = 62/77 (80%) Frame = -3 Query: 232 LFSSAGLIEGRAGMMVHGEILKRGLEFDSFVRVSLVDMYVKVKLLGFALQLFDESPERNK 53 L S A L++ G +HG ++K GLEFDSFVRVSLVDMYVK+ LGF LQLFDESP+RNK Sbjct: 145 LKSVAALVDVGLGRCLHGGVMKLGLEFDSFVRVSLVDMYVKIGELGFGLQLFDESPQRNK 204 Query: 52 LGSVLLWNVLINGCCKV 2 S+LLWNVLINGCCKV Sbjct: 205 AESILLWNVLINGCCKV 221 >XP_017633311.1 PREDICTED: pentatricopeptide repeat-containing protein At1g04840 [Gossypium arboreum] Length = 686 Score = 110 bits (275), Expect = 8e-25 Identities = 54/77 (70%), Positives = 65/77 (84%) Frame = -3 Query: 232 LFSSAGLIEGRAGMMVHGEILKRGLEFDSFVRVSLVDMYVKVKLLGFALQLFDESPERNK 53 L S AGL G+++HG I+K G+EFDSFVRVSLV+MYVK++ +GFALQ+FDESPERNK Sbjct: 154 LKSVAGLGLRFLGLILHGRIIKSGVEFDSFVRVSLVEMYVKLEEMGFALQVFDESPERNK 213 Query: 52 LGSVLLWNVLINGCCKV 2 S+LLWNVLINGCCKV Sbjct: 214 SESILLWNVLINGCCKV 230 >XP_016722344.1 PREDICTED: pentatricopeptide repeat-containing protein At1g04840-like [Gossypium hirsutum] XP_016722345.1 PREDICTED: pentatricopeptide repeat-containing protein At1g04840-like [Gossypium hirsutum] Length = 686 Score = 109 bits (273), Expect = 1e-24 Identities = 54/77 (70%), Positives = 65/77 (84%) Frame = -3 Query: 232 LFSSAGLIEGRAGMMVHGEILKRGLEFDSFVRVSLVDMYVKVKLLGFALQLFDESPERNK 53 L S AGL G+++HG I+K G+EFDSFVRVSLV+MYVK++ +GFALQ+FDESPERNK Sbjct: 154 LKSVAGLGLRFLGLILHGRIIKCGVEFDSFVRVSLVEMYVKLEEMGFALQVFDESPERNK 213 Query: 52 LGSVLLWNVLINGCCKV 2 S+LLWNVLINGCCKV Sbjct: 214 SESILLWNVLINGCCKV 230 >XP_012481710.1 PREDICTED: pentatricopeptide repeat-containing protein At1g04840 [Gossypium raimondii] KJB28163.1 hypothetical protein B456_005G031300 [Gossypium raimondii] Length = 702 Score = 109 bits (272), Expect = 2e-24 Identities = 53/77 (68%), Positives = 65/77 (84%) Frame = -3 Query: 232 LFSSAGLIEGRAGMMVHGEILKRGLEFDSFVRVSLVDMYVKVKLLGFALQLFDESPERNK 53 L S AGL G+++HG I+K G+EFDSFVRVSLV+MYVK++ +GFALQ+FDESPERNK Sbjct: 170 LKSVAGLGLRFLGLILHGRIIKSGVEFDSFVRVSLVEMYVKLEEMGFALQVFDESPERNK 229 Query: 52 LGSVLLWNVLINGCCKV 2 S+LLWNVLINGCC+V Sbjct: 230 SESILLWNVLINGCCRV 246 >EOY05244.1 Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] EOY05245.1 Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] EOY05246.1 Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] EOY05247.1 Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] Length = 682 Score = 108 bits (271), Expect = 3e-24 Identities = 54/76 (71%), Positives = 64/76 (84%) Frame = -3 Query: 232 LFSSAGLIEGRAGMMVHGEILKRGLEFDSFVRVSLVDMYVKVKLLGFALQLFDESPERNK 53 L S AGL G+++HG I+K G+EFDSFVRV+LV+MYVK+K LGFALQ+FDESPERNK Sbjct: 150 LKSIAGLGLRCLGLILHGRIIKSGVEFDSFVRVALVEMYVKLKELGFALQVFDESPERNK 209 Query: 52 LGSVLLWNVLINGCCK 5 GS+LLWNVLING CK Sbjct: 210 SGSILLWNVLINGYCK 225 >XP_007034320.2 PREDICTED: pentatricopeptide repeat-containing protein At1g04840 [Theobroma cacao] XP_007034318.2 PREDICTED: pentatricopeptide repeat-containing protein At1g04840 [Theobroma cacao] XP_007034319.2 PREDICTED: pentatricopeptide repeat-containing protein At1g04840 [Theobroma cacao] Length = 684 Score = 108 bits (271), Expect = 3e-24 Identities = 54/76 (71%), Positives = 64/76 (84%) Frame = -3 Query: 232 LFSSAGLIEGRAGMMVHGEILKRGLEFDSFVRVSLVDMYVKVKLLGFALQLFDESPERNK 53 L S AGL G+++HG I+K G+EFDSFVRV+LV+MYVK+K LGFALQ+FDESPERNK Sbjct: 152 LKSIAGLGLRCLGLILHGRIIKSGVEFDSFVRVALVEMYVKLKELGFALQVFDESPERNK 211 Query: 52 LGSVLLWNVLINGCCK 5 GS+LLWNVLING CK Sbjct: 212 SGSILLWNVLINGYCK 227 >XP_016724232.1 PREDICTED: pentatricopeptide repeat-containing protein At1g04840-like [Gossypium hirsutum] Length = 702 Score = 108 bits (271), Expect = 3e-24 Identities = 53/77 (68%), Positives = 65/77 (84%) Frame = -3 Query: 232 LFSSAGLIEGRAGMMVHGEILKRGLEFDSFVRVSLVDMYVKVKLLGFALQLFDESPERNK 53 L S AGL G+++HG I+K G+EFDSFVRVSLV++YVK++ +GFALQ+FDESPERNK Sbjct: 170 LKSVAGLGLRFLGLILHGRIIKSGVEFDSFVRVSLVEVYVKLEEMGFALQVFDESPERNK 229 Query: 52 LGSVLLWNVLINGCCKV 2 S+LLWNVLINGCCKV Sbjct: 230 SESILLWNVLINGCCKV 246 >OMO71022.1 hypothetical protein CCACVL1_18501 [Corchorus capsularis] Length = 462 Score = 102 bits (254), Expect = 3e-22 Identities = 51/77 (66%), Positives = 61/77 (79%) Frame = -3 Query: 232 LFSSAGLIEGRAGMMVHGEILKRGLEFDSFVRVSLVDMYVKVKLLGFALQLFDESPERNK 53 L S AGL G+++HG I+K G EFDSFVRVSLV++YVK++ LG A Q+FDESPER K Sbjct: 193 LKSIAGLGLRCLGLILHGRIIKCGFEFDSFVRVSLVELYVKLEELGLAFQVFDESPERIK 252 Query: 52 LGSVLLWNVLINGCCKV 2 G +LLWNVLINGCCKV Sbjct: 253 NGRILLWNVLINGCCKV 269 >XP_019236823.1 PREDICTED: pentatricopeptide repeat-containing protein At1g04840 [Nicotiana attenuata] XP_019236824.1 PREDICTED: pentatricopeptide repeat-containing protein At1g04840 [Nicotiana attenuata] XP_019236825.1 PREDICTED: pentatricopeptide repeat-containing protein At1g04840 [Nicotiana attenuata] XP_019236827.1 PREDICTED: pentatricopeptide repeat-containing protein At1g04840 [Nicotiana attenuata] XP_019236828.1 PREDICTED: pentatricopeptide repeat-containing protein At1g04840 [Nicotiana attenuata] OIT22843.1 pentatricopeptide repeat-containing protein [Nicotiana attenuata] Length = 675 Score = 102 bits (255), Expect = 4e-22 Identities = 53/76 (69%), Positives = 58/76 (76%) Frame = -3 Query: 232 LFSSAGLIEGRAGMMVHGEILKRGLEFDSFVRVSLVDMYVKVKLLGFALQLFDESPERNK 53 L S L E G VH E+LK GLE+D FVRV LV+MYVKV+L+ FALQLFDESPERNK Sbjct: 143 LKSLTALGEKGVGGSVHCEVLKMGLEYDVFVRVCLVEMYVKVELVDFALQLFDESPERNK 202 Query: 52 LGSVLLWNVLINGCCK 5 SVLLWNV INGCCK Sbjct: 203 AESVLLWNVAINGCCK 218 >XP_019161716.1 PREDICTED: pentatricopeptide repeat-containing protein At1g04840-like [Ipomoea nil] Length = 677 Score = 102 bits (253), Expect = 7e-22 Identities = 51/77 (66%), Positives = 61/77 (79%) Frame = -3 Query: 232 LFSSAGLIEGRAGMMVHGEILKRGLEFDSFVRVSLVDMYVKVKLLGFALQLFDESPERNK 53 L S GL R G+++H I K GL+ DSFVRVSL DMYVK+ LL FALQ+F+ESPE+NK Sbjct: 145 LKSVMGLRGKRCGVVLHCGIFKMGLDCDSFVRVSLADMYVKIGLLDFALQVFNESPEKNK 204 Query: 52 LGSVLLWNVLINGCCKV 2 + SVLLWNV+INGCCKV Sbjct: 205 VESVLLWNVVINGCCKV 221 >XP_010326841.1 PREDICTED: pentatricopeptide repeat-containing protein At1g04840 [Solanum lycopersicum] XP_004247960.2 PREDICTED: pentatricopeptide repeat-containing protein At1g04840 [Solanum lycopersicum] XP_010326843.1 PREDICTED: pentatricopeptide repeat-containing protein At1g04840 [Solanum lycopersicum] XP_010326844.1 PREDICTED: pentatricopeptide repeat-containing protein At1g04840 [Solanum lycopersicum] Length = 666 Score = 101 bits (251), Expect = 1e-21 Identities = 50/77 (64%), Positives = 61/77 (79%) Frame = -3 Query: 232 LFSSAGLIEGRAGMMVHGEILKRGLEFDSFVRVSLVDMYVKVKLLGFALQLFDESPERNK 53 L S L + R G +VH ILK GLE+D+FVRV LV+MYVK +L+ FALQLFDES ERNK Sbjct: 133 LKSVTALGDKRVGGVVHCGILKMGLEYDTFVRVCLVEMYVKAELVDFALQLFDESSERNK 192 Query: 52 LGSVLLWNVLINGCCKV 2 + SV+LWNV+INGCCK+ Sbjct: 193 VESVILWNVVINGCCKI 209 >XP_006360955.1 PREDICTED: pentatricopeptide repeat-containing protein At1g04840 [Solanum tuberosum] XP_006360956.1 PREDICTED: pentatricopeptide repeat-containing protein At1g04840 [Solanum tuberosum] Length = 666 Score = 100 bits (249), Expect = 2e-21 Identities = 50/77 (64%), Positives = 61/77 (79%) Frame = -3 Query: 232 LFSSAGLIEGRAGMMVHGEILKRGLEFDSFVRVSLVDMYVKVKLLGFALQLFDESPERNK 53 L S L E G VH +LK GLE+D+FVRV LV++YVKV+L+ FALQLFDESPERNK Sbjct: 133 LKSVTALGEKGVGGGVHCGVLKVGLEYDTFVRVCLVELYVKVELVDFALQLFDESPERNK 192 Query: 52 LGSVLLWNVLINGCCKV 2 + SV+LWNV+INGCCK+ Sbjct: 193 VESVILWNVVINGCCKI 209 >XP_009768191.1 PREDICTED: pentatricopeptide repeat-containing protein At1g04840 [Nicotiana sylvestris] XP_009768192.1 PREDICTED: pentatricopeptide repeat-containing protein At1g04840 [Nicotiana sylvestris] XP_009768194.1 PREDICTED: pentatricopeptide repeat-containing protein At1g04840 [Nicotiana sylvestris] XP_016463288.1 PREDICTED: pentatricopeptide repeat-containing protein At1g04840-like [Nicotiana tabacum] XP_016463289.1 PREDICTED: pentatricopeptide repeat-containing protein At1g04840-like [Nicotiana tabacum] XP_016463290.1 PREDICTED: pentatricopeptide repeat-containing protein At1g04840-like [Nicotiana tabacum] Length = 674 Score = 99.4 bits (246), Expect = 6e-21 Identities = 50/76 (65%), Positives = 57/76 (75%) Frame = -3 Query: 232 LFSSAGLIEGRAGMMVHGEILKRGLEFDSFVRVSLVDMYVKVKLLGFALQLFDESPERNK 53 L S L E G VH +LK GLE+D FVRV LV+MYVK++L+ FALQLFDESPERNK Sbjct: 142 LKSLTALGENGVGGSVHCGVLKMGLEYDVFVRVCLVEMYVKIELVVFALQLFDESPERNK 201 Query: 52 LGSVLLWNVLINGCCK 5 SVLLWN+ INGCCK Sbjct: 202 AESVLLWNIAINGCCK 217 >XP_016479905.1 PREDICTED: pentatricopeptide repeat-containing protein At1g04840-like [Nicotiana tabacum] Length = 675 Score = 99.4 bits (246), Expect = 6e-21 Identities = 51/76 (67%), Positives = 57/76 (75%) Frame = -3 Query: 232 LFSSAGLIEGRAGMMVHGEILKRGLEFDSFVRVSLVDMYVKVKLLGFALQLFDESPERNK 53 L S L E G VH +LK GLE+D FVRV LV+MYVK++L+ FALQLFDESPERNK Sbjct: 143 LKSLTALGEKGVGGSVHCGVLKMGLEYDVFVRVCLVEMYVKIELVEFALQLFDESPERNK 202 Query: 52 LGSVLLWNVLINGCCK 5 SVLLWNV INGCCK Sbjct: 203 AESVLLWNVAINGCCK 218 >XP_009610515.1 PREDICTED: pentatricopeptide repeat-containing protein At1g04840 [Nicotiana tomentosiformis] XP_018628952.1 PREDICTED: pentatricopeptide repeat-containing protein At1g04840 [Nicotiana tomentosiformis] XP_018628953.1 PREDICTED: pentatricopeptide repeat-containing protein At1g04840 [Nicotiana tomentosiformis] Length = 675 Score = 99.4 bits (246), Expect = 6e-21 Identities = 51/76 (67%), Positives = 57/76 (75%) Frame = -3 Query: 232 LFSSAGLIEGRAGMMVHGEILKRGLEFDSFVRVSLVDMYVKVKLLGFALQLFDESPERNK 53 L S L E G VH +LK GLE+D FVRV LV+MYVK++L+ FALQLFDESPERNK Sbjct: 143 LKSLTALGEKGVGGSVHCGVLKMGLEYDVFVRVCLVEMYVKIELVEFALQLFDESPERNK 202 Query: 52 LGSVLLWNVLINGCCK 5 SVLLWNV INGCCK Sbjct: 203 AESVLLWNVAINGCCK 218 >XP_010274081.1 PREDICTED: pentatricopeptide repeat-containing protein At1g04840 [Nelumbo nucifera] Length = 668 Score = 98.6 bits (244), Expect = 1e-20 Identities = 49/76 (64%), Positives = 57/76 (75%) Frame = -3 Query: 232 LFSSAGLIEGRAGMMVHGEILKRGLEFDSFVRVSLVDMYVKVKLLGFALQLFDESPERNK 53 L S+A L+ G +H + +K GLE DSF+RVSLVDMYVKV L FALQLFDE+PE NK Sbjct: 136 LKSAASLLAHGLGRSLHAQTVKLGLELDSFIRVSLVDMYVKVDYLDFALQLFDETPEGNK 195 Query: 52 LGSVLLWNVLINGCCK 5 S+LLWNVLING CK Sbjct: 196 CASILLWNVLINGYCK 211 >XP_016566366.1 PREDICTED: pentatricopeptide repeat-containing protein At1g04840 [Capsicum annuum] XP_016566367.1 PREDICTED: pentatricopeptide repeat-containing protein At1g04840 [Capsicum annuum] XP_016566368.1 PREDICTED: pentatricopeptide repeat-containing protein At1g04840 [Capsicum annuum] XP_016566370.1 PREDICTED: pentatricopeptide repeat-containing protein At1g04840 [Capsicum annuum] Length = 667 Score = 97.1 bits (240), Expect = 4e-20 Identities = 45/61 (73%), Positives = 53/61 (86%) Frame = -3 Query: 187 VHGEILKRGLEFDSFVRVSLVDMYVKVKLLGFALQLFDESPERNKLGSVLLWNVLINGCC 8 VH I+K G E+D FVRV LV+MYVKV+L+ +ALQLFDESPERNK+ SVLLWNV+INGCC Sbjct: 148 VHSGIVKMGFEYDVFVRVCLVEMYVKVELVDYALQLFDESPERNKVESVLLWNVVINGCC 207 Query: 7 K 5 K Sbjct: 208 K 208 >XP_004139010.1 PREDICTED: pentatricopeptide repeat-containing protein At1g04840 [Cucumis sativus] KGN61483.1 hypothetical protein Csa_2G139850 [Cucumis sativus] Length = 679 Score = 97.1 bits (240), Expect = 4e-20 Identities = 51/77 (66%), Positives = 60/77 (77%) Frame = -3 Query: 232 LFSSAGLIEGRAGMMVHGEILKRGLEFDSFVRVSLVDMYVKVKLLGFALQLFDESPERNK 53 L S+A L G G +H ILK GLEFDSFVRVSLVDMYVKV+ LG AL++FDESPE K Sbjct: 147 LKSAAALSNGGVGRALHCGILKFGLEFDSFVRVSLVDMYVKVEELGSALKVFDESPESVK 206 Query: 52 LGSVLLWNVLINGCCKV 2 GSVL+WNVLI+G C++ Sbjct: 207 NGSVLIWNVLIHGYCRM 223 >OMO88605.1 hypothetical protein COLO4_20168 [Corchorus olitorius] Length = 691 Score = 97.1 bits (240), Expect = 4e-20 Identities = 50/77 (64%), Positives = 60/77 (77%) Frame = -3 Query: 232 LFSSAGLIEGRAGMMVHGEILKRGLEFDSFVRVSLVDMYVKVKLLGFALQLFDESPERNK 53 L S AGL G+++HG I K G EFDSFVRVSLV++YV ++ LG ALQ+F+ESPER K Sbjct: 159 LKSIAGLGLRFLGLILHGRITKCGFEFDSFVRVSLVELYVNLEELGLALQVFEESPERIK 218 Query: 52 LGSVLLWNVLINGCCKV 2 GS+LLWNVLING CKV Sbjct: 219 NGSILLWNVLINGYCKV 235