BLASTX nr result
ID: Panax24_contig00014528
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00014528 (475 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017244899.1 PREDICTED: coatomer subunit epsilon-1-like [Daucu... 57 8e-07 >XP_017244899.1 PREDICTED: coatomer subunit epsilon-1-like [Daucus carota subsp. sativus] KZN11172.1 hypothetical protein DCAR_003828 [Daucus carota subsp. sativus] Length = 290 Score = 57.4 bits (137), Expect = 8e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 475 QLKLSQPDHMLVKRVSAGEEAFDRAVQTVA 386 QLKLSQ DHMLVKR+SAGEEAFDRAVQTVA Sbjct: 261 QLKLSQADHMLVKRISAGEEAFDRAVQTVA 290