BLASTX nr result
ID: Panax24_contig00014509
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00014509 (449 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AQK92796.1 Kinesin-like protein KIN-13A [Zea mays] 59 3e-07 GAU11174.1 hypothetical protein TSUD_197980, partial [Trifolium ... 53 1e-06 OIT30964.1 kinesin-13a [Nicotiana attenuata] 55 2e-06 GAU33773.1 hypothetical protein TSUD_393350 [Trifolium subterran... 55 4e-06 XP_011009837.1 PREDICTED: kinesin-13A-like [Populus euphratica] 55 4e-06 XP_017226985.1 PREDICTED: kinesin-13A-like [Daucus carota subsp.... 55 4e-06 XP_013463240.1 kinesin motor catalytic domain protein [Medicago ... 55 5e-06 XP_019172879.1 PREDICTED: kinesin-like protein KIN-13A [Ipomoea ... 55 5e-06 XP_004487846.1 PREDICTED: kinesin-13A-like [Cicer arietinum] XP_... 55 6e-06 XP_013463239.1 kinesin motor catalytic domain protein [Medicago ... 55 6e-06 CDM83011.1 unnamed protein product [Triticum aestivum] 55 7e-06 BAK07308.1 predicted protein [Hordeum vulgare subsp. vulgare] 55 7e-06 XP_020153143.1 kinesin-like protein KIN-13A [Aegilops tauschii s... 55 7e-06 >AQK92796.1 Kinesin-like protein KIN-13A [Zea mays] Length = 831 Score = 58.5 bits (140), Expect = 3e-07 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +1 Query: 139 SFCFAWMVDLTTYVDKHEFCFDSVLDEQVTNDEV 240 ++ F W VDLT YV+KHEFCFD+VLDE V+NDEV Sbjct: 247 TYSFHWKVDLTAYVEKHEFCFDAVLDEHVSNDEV 280 >GAU11174.1 hypothetical protein TSUD_197980, partial [Trifolium subterraneum] Length = 70 Score = 52.8 bits (125), Expect = 1e-06 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = +1 Query: 160 VDLTTYVDKHEFCFDSVLDEQVTNDEV 240 VDLT YV+KHEFCFD+V+DE VTNDEV Sbjct: 1 VDLTAYVEKHEFCFDAVIDENVTNDEV 27 >OIT30964.1 kinesin-13a [Nicotiana attenuata] Length = 248 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +1 Query: 160 VDLTTYVDKHEFCFDSVLDEQVTNDEV 240 VDLTTYV+KHEFCFD+VLDE VTNDEV Sbjct: 167 VDLTTYVEKHEFCFDAVLDEHVTNDEV 193 >GAU33773.1 hypothetical protein TSUD_393350 [Trifolium subterraneum] Length = 807 Score = 55.5 bits (132), Expect = 4e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +1 Query: 160 VDLTTYVDKHEFCFDSVLDEQVTNDEV 240 VDLT YV+KHEFCFD+VLDEQVTNDEV Sbjct: 237 VDLTAYVEKHEFCFDAVLDEQVTNDEV 263 >XP_011009837.1 PREDICTED: kinesin-13A-like [Populus euphratica] Length = 815 Score = 55.5 bits (132), Expect = 4e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +1 Query: 160 VDLTTYVDKHEFCFDSVLDEQVTNDEV 240 VDLT YV+KHEFCFD+VLDEQVTNDEV Sbjct: 247 VDLTAYVEKHEFCFDAVLDEQVTNDEV 273 >XP_017226985.1 PREDICTED: kinesin-13A-like [Daucus carota subsp. sativus] KZM82955.1 hypothetical protein DCAR_030524 [Daucus carota subsp. sativus] Length = 816 Score = 55.5 bits (132), Expect = 4e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +1 Query: 160 VDLTTYVDKHEFCFDSVLDEQVTNDEV 240 VDLT YV+KHEFCFD+VLDEQVTNDEV Sbjct: 243 VDLTAYVEKHEFCFDAVLDEQVTNDEV 269 >XP_013463240.1 kinesin motor catalytic domain protein [Medicago truncatula] KEH37253.1 kinesin motor catalytic domain protein [Medicago truncatula] Length = 798 Score = 55.1 bits (131), Expect = 5e-06 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = +1 Query: 160 VDLTTYVDKHEFCFDSVLDEQVTNDEV 240 VDLT YVDKHEFCFD+VLDE VTNDEV Sbjct: 157 VDLTAYVDKHEFCFDAVLDEHVTNDEV 183 >XP_019172879.1 PREDICTED: kinesin-like protein KIN-13A [Ipomoea nil] Length = 805 Score = 55.1 bits (131), Expect = 5e-06 Identities = 36/71 (50%), Positives = 41/71 (57%), Gaps = 1/71 (1%) Frame = +1 Query: 31 KRP-NRWRLSRLNM*KLDKIASFKSIILFLSVGRTNFSFCFAWMVDLTTYVDKHEFCFDS 207 KRP NR +SR K D I + S L+V VDLT YV+KHEFCFD+ Sbjct: 206 KRPLNRKEISR----KEDDIVTVSSDDCCLTVHEPKLK------VDLTAYVEKHEFCFDA 255 Query: 208 VLDEQVTNDEV 240 VLDE VTNDEV Sbjct: 256 VLDEHVTNDEV 266 >XP_004487846.1 PREDICTED: kinesin-13A-like [Cicer arietinum] XP_004487847.1 PREDICTED: kinesin-13A-like [Cicer arietinum] XP_004487848.1 PREDICTED: kinesin-13A-like [Cicer arietinum] Length = 833 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = +1 Query: 160 VDLTTYVDKHEFCFDSVLDEQVTNDEV 240 VDLT YVDKHEFCFD+VLDE VTNDEV Sbjct: 235 VDLTAYVDKHEFCFDAVLDEHVTNDEV 261 >XP_013463239.1 kinesin motor catalytic domain protein [Medicago truncatula] KEH37252.1 kinesin motor catalytic domain protein [Medicago truncatula] Length = 878 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = +1 Query: 160 VDLTTYVDKHEFCFDSVLDEQVTNDEV 240 VDLT YVDKHEFCFD+VLDE VTNDEV Sbjct: 237 VDLTAYVDKHEFCFDAVLDEHVTNDEV 263 >CDM83011.1 unnamed protein product [Triticum aestivum] Length = 791 Score = 54.7 bits (130), Expect = 7e-06 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = +1 Query: 160 VDLTTYVDKHEFCFDSVLDEQVTNDEV 240 VDLT YVDKHEFCFD+VLDE VTNDEV Sbjct: 216 VDLTAYVDKHEFCFDAVLDEAVTNDEV 242 >BAK07308.1 predicted protein [Hordeum vulgare subsp. vulgare] Length = 792 Score = 54.7 bits (130), Expect = 7e-06 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = +1 Query: 160 VDLTTYVDKHEFCFDSVLDEQVTNDEV 240 VDLT YVDKHEFCFD+VLDE VTNDEV Sbjct: 217 VDLTAYVDKHEFCFDAVLDEAVTNDEV 243 >XP_020153143.1 kinesin-like protein KIN-13A [Aegilops tauschii subsp. tauschii] Length = 799 Score = 54.7 bits (130), Expect = 7e-06 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = +1 Query: 160 VDLTTYVDKHEFCFDSVLDEQVTNDEV 240 VDLT YVDKHEFCFD+VLDE VTNDEV Sbjct: 225 VDLTAYVDKHEFCFDAVLDEAVTNDEV 251