BLASTX nr result
ID: Panax24_contig00014267
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00014267 (476 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010113281.1 Ankyrin repeat domain-containing protein [Morus n... 64 6e-09 EOX90735.1 Ankyrin repeat protein [Theobroma cacao] 64 8e-09 GAV78581.1 Ank_2 domain-containing protein [Cephalotus follicula... 63 1e-08 XP_008337962.1 PREDICTED: LOW QUALITY PROTEIN: ankyrin repeat do... 63 1e-08 KVH92264.1 Ankyrin repeat-containing protein [Cynara cardunculus... 63 1e-08 XP_004287763.2 PREDICTED: ankyrin repeat domain-containing prote... 62 2e-08 CDP08503.1 unnamed protein product [Coffea canephora] 62 2e-08 OMO83441.1 hypothetical protein COLO4_22501 [Corchorus olitorius] 62 3e-08 XP_016651632.1 PREDICTED: ankyrin repeat domain-containing prote... 61 5e-08 XP_007202126.1 hypothetical protein PRUPE_ppa006031mg [Prunus pe... 61 5e-08 XP_009798518.1 PREDICTED: ankyrin repeat domain-containing prote... 57 7e-08 XP_010088071.1 Ankyrin repeat domain-containing protein [Morus n... 57 2e-07 XP_010557532.1 PREDICTED: ankyrin repeat domain-containing prote... 59 2e-07 XP_018504480.1 PREDICTED: ankyrin repeat domain-containing prote... 59 2e-07 XP_006367165.1 PREDICTED: ankyrin repeat domain-containing prote... 59 2e-07 XP_004233572.1 PREDICTED: ankyrin repeat domain-containing prote... 59 2e-07 XP_015064736.1 PREDICTED: ankyrin repeat domain-containing prote... 59 2e-07 XP_017697437.1 PREDICTED: ankyrin repeat domain-containing prote... 59 3e-07 XP_006425344.1 hypothetical protein CICLE_v10025620mg [Citrus cl... 59 3e-07 KDO71364.1 hypothetical protein CISIN_1g013643mg [Citrus sinensis] 59 3e-07 >XP_010113281.1 Ankyrin repeat domain-containing protein [Morus notabilis] EXC35288.1 Ankyrin repeat domain-containing protein [Morus notabilis] Length = 683 Score = 63.9 bits (154), Expect = 6e-09 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 476 NRDGLTPLDLCLYSGRDTRTYEQIKLIKMLPKWR 375 N+DGLTPLDLCLYSGRDTRTYE IK++K+LPK R Sbjct: 650 NKDGLTPLDLCLYSGRDTRTYELIKVLKLLPKQR 683 >EOX90735.1 Ankyrin repeat protein [Theobroma cacao] Length = 683 Score = 63.5 bits (153), Expect = 8e-09 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -1 Query: 476 NRDGLTPLDLCLYSGRDTRTYEQIKLIKMLPKWR 375 N+DGLTPLDLCLYSGRDTRTYE IKL+K LPK R Sbjct: 650 NKDGLTPLDLCLYSGRDTRTYELIKLLKQLPKPR 683 >GAV78581.1 Ank_2 domain-containing protein [Cephalotus follicularis] Length = 425 Score = 63.2 bits (152), Expect = 1e-08 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -1 Query: 476 NRDGLTPLDLCLYSGRDTRTYEQIKLIKMLPKWR 375 NRDGLTPLDLCLYSGR TRTYE IKL+K LPK R Sbjct: 392 NRDGLTPLDLCLYSGRSTRTYELIKLLKQLPKQR 425 >XP_008337962.1 PREDICTED: LOW QUALITY PROTEIN: ankyrin repeat domain-containing protein, chloroplastic [Malus domestica] Length = 428 Score = 63.2 bits (152), Expect = 1e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 476 NRDGLTPLDLCLYSGRDTRTYEQIKLIKMLPKWR 375 N+DGLTPLDLCLYSG+DTRTYE IKL+K+LPK R Sbjct: 395 NKDGLTPLDLCLYSGQDTRTYELIKLLKLLPKSR 428 >KVH92264.1 Ankyrin repeat-containing protein [Cynara cardunculus var. scolymus] Length = 444 Score = 62.8 bits (151), Expect = 1e-08 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -1 Query: 476 NRDGLTPLDLCLYSGRDTRTYEQIKLIKMLPKWRKH 369 N+DGLTPLDLCLYSGRDTRTYE I+L+K PK RK+ Sbjct: 404 NQDGLTPLDLCLYSGRDTRTYEMIRLLKQPPKPRKY 439 >XP_004287763.2 PREDICTED: ankyrin repeat domain-containing protein, chloroplastic [Fragaria vesca subsp. vesca] Length = 656 Score = 62.4 bits (150), Expect = 2e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -1 Query: 476 NRDGLTPLDLCLYSGRDTRTYEQIKLIKMLPKWR 375 N+DGLTPL+LCLYSGRDTRTYE IK++K+LPK R Sbjct: 623 NKDGLTPLELCLYSGRDTRTYELIKVLKLLPKTR 656 >CDP08503.1 unnamed protein product [Coffea canephora] Length = 447 Score = 62.0 bits (149), Expect = 2e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 476 NRDGLTPLDLCLYSGRDTRTYEQIKLIKMLPK 381 N+DGLTPLDLCLYSGRDTRTYE IKL+K LP+ Sbjct: 412 NKDGLTPLDLCLYSGRDTRTYELIKLLKQLPR 443 >OMO83441.1 hypothetical protein COLO4_22501 [Corchorus olitorius] Length = 389 Score = 61.6 bits (148), Expect = 3e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 476 NRDGLTPLDLCLYSGRDTRTYEQIKLIKMLPKWR 375 N+DGLTPLDLCLYSGRDTRTYE IKL+K PK R Sbjct: 235 NKDGLTPLDLCLYSGRDTRTYELIKLLKYTPKSR 268 >XP_016651632.1 PREDICTED: ankyrin repeat domain-containing protein, chloroplastic [Prunus mume] Length = 431 Score = 61.2 bits (147), Expect = 5e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -1 Query: 476 NRDGLTPLDLCLYSGRDTRTYEQIKLIKMLPKWR 375 N+DGLTPLDLCLYSG++TRTYE IKL+K+LPK R Sbjct: 398 NKDGLTPLDLCLYSGQETRTYELIKLLKLLPKPR 431 >XP_007202126.1 hypothetical protein PRUPE_ppa006031mg [Prunus persica] ONH97203.1 hypothetical protein PRUPE_7G175600 [Prunus persica] Length = 431 Score = 61.2 bits (147), Expect = 5e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -1 Query: 476 NRDGLTPLDLCLYSGRDTRTYEQIKLIKMLPKWR 375 N+DGLTPLDLCLYSG++TRTYE IKL+K+LPK R Sbjct: 398 NKDGLTPLDLCLYSGQETRTYELIKLLKLLPKPR 431 >XP_009798518.1 PREDICTED: ankyrin repeat domain-containing protein, chloroplastic-like [Nicotiana sylvestris] Length = 93 Score = 57.0 bits (136), Expect = 7e-08 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 476 NRDGLTPLDLCLYSGRDTRTYEQIKLIKMLPK 381 NRDGLTPLD+CL+ GRD RTYE IKL+K LPK Sbjct: 60 NRDGLTPLDICLHYGRDIRTYELIKLLKQLPK 91 >XP_010088071.1 Ankyrin repeat domain-containing protein [Morus notabilis] EXB31390.1 Ankyrin repeat domain-containing protein [Morus notabilis] Length = 150 Score = 57.4 bits (137), Expect = 2e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 476 NRDGLTPLDLCLYSGRDTRTYEQIKLIKMLPKWR 375 N+DGLTPL+LCLY RDTRTYE IK++K+LPK R Sbjct: 117 NKDGLTPLNLCLYYSRDTRTYELIKVLKLLPKQR 150 >XP_010557532.1 PREDICTED: ankyrin repeat domain-containing protein, chloroplastic [Tarenaya hassleriana] Length = 421 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -1 Query: 476 NRDGLTPLDLCLYSGRDTRTYEQIKLIKMLPKWRKHNS 363 N+DGLTPL LCLYSGRDTRTYE IKL+K +P+ R+ ++ Sbjct: 380 NKDGLTPLGLCLYSGRDTRTYELIKLLKEVPRSRRKSA 417 >XP_018504480.1 PREDICTED: ankyrin repeat domain-containing protein, chloroplastic-like [Pyrus x bretschneideri] XP_018498614.1 PREDICTED: ankyrin repeat domain-containing protein, chloroplastic-like [Pyrus x bretschneideri] Length = 428 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 476 NRDGLTPLDLCLYSGRDTRTYEQIKLIKMLPKWR 375 N+DGL+PLDLCLYSG+D RTYE IKL+K+LPK R Sbjct: 395 NKDGLSPLDLCLYSGQDMRTYELIKLLKLLPKSR 428 >XP_006367165.1 PREDICTED: ankyrin repeat domain-containing protein, chloroplastic [Solanum tuberosum] Length = 452 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 476 NRDGLTPLDLCLYSGRDTRTYEQIKLIKMLPK 381 NRDGLTPLD+CL+SGRD RTYE IKL+K LPK Sbjct: 414 NRDGLTPLDICLHSGRDIRTYELIKLLKQLPK 445 >XP_004233572.1 PREDICTED: ankyrin repeat domain-containing protein, chloroplastic [Solanum lycopersicum] Length = 453 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 476 NRDGLTPLDLCLYSGRDTRTYEQIKLIKMLPK 381 NRDGLTPLD+CL+SGRD RTYE IKL+K LPK Sbjct: 415 NRDGLTPLDICLHSGRDIRTYELIKLLKQLPK 446 >XP_015064736.1 PREDICTED: ankyrin repeat domain-containing protein, chloroplastic [Solanum pennellii] Length = 717 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 476 NRDGLTPLDLCLYSGRDTRTYEQIKLIKMLPK 381 NRDGLTPLD+CL+SGRD RTYE IKL+K LPK Sbjct: 679 NRDGLTPLDICLHSGRDIRTYELIKLLKQLPK 710 >XP_017697437.1 PREDICTED: ankyrin repeat domain-containing protein, chloroplastic isoform X4 [Phoenix dactylifera] Length = 423 Score = 58.9 bits (141), Expect = 3e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 476 NRDGLTPLDLCLYSGRDTRTYEQIKLIKMLP 384 NRDGLTPLDLCLYSGRD RTYE IKL+K LP Sbjct: 387 NRDGLTPLDLCLYSGRDLRTYELIKLLKGLP 417 >XP_006425344.1 hypothetical protein CICLE_v10025620mg [Citrus clementina] ESR38584.1 hypothetical protein CICLE_v10025620mg [Citrus clementina] Length = 438 Score = 58.9 bits (141), Expect = 3e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 476 NRDGLTPLDLCLYSGRDTRTYEQIKLIKMLP 384 NRDGLTPLDLCLYSGRDTRT+ IKL+K LP Sbjct: 405 NRDGLTPLDLCLYSGRDTRTFGMIKLLKQLP 435 >KDO71364.1 hypothetical protein CISIN_1g013643mg [Citrus sinensis] Length = 439 Score = 58.9 bits (141), Expect = 3e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 476 NRDGLTPLDLCLYSGRDTRTYEQIKLIKMLP 384 NRDGLTPLDLCLYSGRDTRT+ IKL+K LP Sbjct: 406 NRDGLTPLDLCLYSGRDTRTFGMIKLLKQLP 436