BLASTX nr result
ID: Panax24_contig00014242
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00014242 (403 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BAD94046.1 AT5g16610/MTG13_5, partial [Arabidopsis thaliana] 74 4e-13 KRH17343.1 hypothetical protein GLYMA_14G214400 [Glycine max] 74 8e-13 NP_197164.2 hypothetical protein AT5G16610 [Arabidopsis thaliana... 74 1e-12 BAB10188.1 unnamed protein product [Arabidopsis thaliana] 74 1e-12 XP_006400199.1 hypothetical protein EUTSA_v10012945mg [Eutrema s... 74 1e-12 OAO94872.1 hypothetical protein AXX17_AT5G16230 [Arabidopsis tha... 74 1e-12 NP_974791.1 hypothetical protein AT5G16610 [Arabidopsis thaliana... 74 1e-12 XP_002873786.1 hypothetical protein ARALYDRAFT_488520 [Arabidops... 74 1e-12 NP_001331235.1 hypothetical protein AT5G16610 [Arabidopsis thali... 73 2e-12 XP_019185620.1 PREDICTED: uncharacterized protein LOC109180469 i... 73 2e-12 XP_019185619.1 PREDICTED: uncharacterized protein LOC109180469 i... 73 2e-12 XP_019185618.1 PREDICTED: uncharacterized protein LOC109180469 i... 73 2e-12 KCW69380.1 hypothetical protein EUGRSUZ_F02863, partial [Eucalyp... 69 3e-12 XP_010108986.1 hypothetical protein L484_027182 [Morus notabilis... 72 3e-12 CDP01636.1 unnamed protein product [Coffea canephora] 72 3e-12 XP_015869907.1 PREDICTED: uncharacterized protein LOC107407181 [... 72 4e-12 XP_015869207.1 PREDICTED: uncharacterized protein LOC107406577 [... 72 4e-12 XP_019089948.1 PREDICTED: uncharacterized protein LOC104735694 [... 72 4e-12 JAU57261.1 hypothetical protein LE_TR11233_c1_g1_i1_g.37199 [Noc... 72 4e-12 KYP42211.1 hypothetical protein KK1_036396 [Cajanus cajan] 72 4e-12 >BAD94046.1 AT5g16610/MTG13_5, partial [Arabidopsis thaliana] Length = 273 Score = 73.6 bits (179), Expect = 4e-13 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 401 ARYLQFRKWPVEWGWCRDLQSFILIFERHNRCI 303 ARYLQFRKWPVEWGWCRDLQSFI +FERHNR + Sbjct: 101 ARYLQFRKWPVEWGWCRDLQSFIFVFERHNRIV 133 >KRH17343.1 hypothetical protein GLYMA_14G214400 [Glycine max] Length = 530 Score = 73.9 bits (180), Expect = 8e-13 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -3 Query: 398 RYLQFRKWPVEWGWCRDLQSFILIFERHNRCI 303 RYL+FRKWPVEWGWCRDLQSFI +FERHNRC+ Sbjct: 481 RYLKFRKWPVEWGWCRDLQSFIFVFERHNRCL 512 >NP_197164.2 hypothetical protein AT5G16610 [Arabidopsis thaliana] AAL84952.1 AT5g16610/MTG13_5 [Arabidopsis thaliana] AAN33207.1 At5g16610/MTG13_5 [Arabidopsis thaliana] AED92316.1 hypothetical protein AT5G16610 [Arabidopsis thaliana] Length = 529 Score = 73.6 bits (179), Expect = 1e-12 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 401 ARYLQFRKWPVEWGWCRDLQSFILIFERHNRCI 303 ARYLQFRKWPVEWGWCRDLQSFI +FERHNR + Sbjct: 357 ARYLQFRKWPVEWGWCRDLQSFIFVFERHNRIV 389 >BAB10188.1 unnamed protein product [Arabidopsis thaliana] Length = 609 Score = 73.6 bits (179), Expect = 1e-12 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 401 ARYLQFRKWPVEWGWCRDLQSFILIFERHNRCI 303 ARYLQFRKWPVEWGWCRDLQSFI +FERHNR + Sbjct: 437 ARYLQFRKWPVEWGWCRDLQSFIFVFERHNRIV 469 >XP_006400199.1 hypothetical protein EUTSA_v10012945mg [Eutrema salsugineum] ESQ41652.1 hypothetical protein EUTSA_v10012945mg [Eutrema salsugineum] Length = 639 Score = 73.6 bits (179), Expect = 1e-12 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 401 ARYLQFRKWPVEWGWCRDLQSFILIFERHNRCI 303 ARYLQFRKWPVEWGWCRDLQSFI +FERHNR + Sbjct: 469 ARYLQFRKWPVEWGWCRDLQSFIFVFERHNRIV 501 >OAO94872.1 hypothetical protein AXX17_AT5G16230 [Arabidopsis thaliana] Length = 673 Score = 73.6 bits (179), Expect = 1e-12 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 401 ARYLQFRKWPVEWGWCRDLQSFILIFERHNRCI 303 ARYLQFRKWPVEWGWCRDLQSFI +FERHNR + Sbjct: 501 ARYLQFRKWPVEWGWCRDLQSFIFVFERHNRIV 533 >NP_974791.1 hypothetical protein AT5G16610 [Arabidopsis thaliana] AED92317.1 hypothetical protein AT5G16610 [Arabidopsis thaliana] Length = 673 Score = 73.6 bits (179), Expect = 1e-12 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 401 ARYLQFRKWPVEWGWCRDLQSFILIFERHNRCI 303 ARYLQFRKWPVEWGWCRDLQSFI +FERHNR + Sbjct: 501 ARYLQFRKWPVEWGWCRDLQSFIFVFERHNRIV 533 >XP_002873786.1 hypothetical protein ARALYDRAFT_488520 [Arabidopsis lyrata subsp. lyrata] EFH50045.1 hypothetical protein ARALYDRAFT_488520 [Arabidopsis lyrata subsp. lyrata] Length = 687 Score = 73.6 bits (179), Expect = 1e-12 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 401 ARYLQFRKWPVEWGWCRDLQSFILIFERHNRCI 303 ARYLQFRKWPVEWGWCRDLQSFI +FERHNR + Sbjct: 514 ARYLQFRKWPVEWGWCRDLQSFIFVFERHNRIV 546 >NP_001331235.1 hypothetical protein AT5G16610 [Arabidopsis thaliana] ANM69566.1 hypothetical protein AT5G16610 [Arabidopsis thaliana] Length = 531 Score = 72.8 bits (177), Expect = 2e-12 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 401 ARYLQFRKWPVEWGWCRDLQSFILIFERHNR 309 ARYLQFRKWPVEWGWCRDLQSFI +FERHNR Sbjct: 501 ARYLQFRKWPVEWGWCRDLQSFIFVFERHNR 531 >XP_019185620.1 PREDICTED: uncharacterized protein LOC109180469 isoform X3 [Ipomoea nil] Length = 601 Score = 72.8 bits (177), Expect = 2e-12 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 401 ARYLQFRKWPVEWGWCRDLQSFILIFERHNRCI 303 ARYLQFRKWPVEWGWCRD+QSFI +FERHNR + Sbjct: 429 ARYLQFRKWPVEWGWCRDIQSFIFVFERHNRIV 461 >XP_019185619.1 PREDICTED: uncharacterized protein LOC109180469 isoform X2 [Ipomoea nil] Length = 646 Score = 72.8 bits (177), Expect = 2e-12 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 401 ARYLQFRKWPVEWGWCRDLQSFILIFERHNRCI 303 ARYLQFRKWPVEWGWCRD+QSFI +FERHNR + Sbjct: 474 ARYLQFRKWPVEWGWCRDIQSFIFVFERHNRIV 506 >XP_019185618.1 PREDICTED: uncharacterized protein LOC109180469 isoform X1 [Ipomoea nil] Length = 678 Score = 72.8 bits (177), Expect = 2e-12 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 401 ARYLQFRKWPVEWGWCRDLQSFILIFERHNRCI 303 ARYLQFRKWPVEWGWCRD+QSFI +FERHNR + Sbjct: 506 ARYLQFRKWPVEWGWCRDIQSFIFVFERHNRIV 538 >KCW69380.1 hypothetical protein EUGRSUZ_F02863, partial [Eucalyptus grandis] Length = 125 Score = 68.6 bits (166), Expect = 3e-12 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -3 Query: 398 RYLQFRKWPVEWGWCRDLQSFILIFERHNRCI 303 RYL FRKWP EWGWCRDLQSFI +FERHNR + Sbjct: 45 RYLHFRKWPAEWGWCRDLQSFIFVFERHNRIV 76 >XP_010108986.1 hypothetical protein L484_027182 [Morus notabilis] EXC20626.1 hypothetical protein L484_027182 [Morus notabilis] Length = 635 Score = 72.4 bits (176), Expect = 3e-12 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 398 RYLQFRKWPVEWGWCRDLQSFILIFERHNRCI 303 RYLQFRKWPVEWGWCRDLQSFI IFERHNR + Sbjct: 442 RYLQFRKWPVEWGWCRDLQSFIFIFERHNRIV 473 >CDP01636.1 unnamed protein product [Coffea canephora] Length = 746 Score = 72.4 bits (176), Expect = 3e-12 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 401 ARYLQFRKWPVEWGWCRDLQSFILIFERHNRCI 303 ARYLQFRKWPVEWGWCRDLQ+FI +FERHNR + Sbjct: 577 ARYLQFRKWPVEWGWCRDLQAFIFVFERHNRIV 609 >XP_015869907.1 PREDICTED: uncharacterized protein LOC107407181 [Ziziphus jujuba] Length = 554 Score = 72.0 bits (175), Expect = 4e-12 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -3 Query: 398 RYLQFRKWPVEWGWCRDLQSFILIFERHNRCI 303 RYLQFRKWPVEWGWCRDLQSFI +FERHNR + Sbjct: 386 RYLQFRKWPVEWGWCRDLQSFIFVFERHNRLV 417 >XP_015869207.1 PREDICTED: uncharacterized protein LOC107406577 [Ziziphus jujuba] Length = 554 Score = 72.0 bits (175), Expect = 4e-12 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -3 Query: 398 RYLQFRKWPVEWGWCRDLQSFILIFERHNRCI 303 RYLQFRKWPVEWGWCRDLQSFI +FERHNR + Sbjct: 386 RYLQFRKWPVEWGWCRDLQSFIFVFERHNRLV 417 >XP_019089948.1 PREDICTED: uncharacterized protein LOC104735694 [Camelina sativa] Length = 562 Score = 72.0 bits (175), Expect = 4e-12 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 401 ARYLQFRKWPVEWGWCRDLQSFILIFERHNRCI 303 ARYL+FRKWPVEWGWCRDLQSFI +FERHNR + Sbjct: 523 ARYLRFRKWPVEWGWCRDLQSFIFVFERHNRIV 555 >JAU57261.1 hypothetical protein LE_TR11233_c1_g1_i1_g.37199 [Noccaea caerulescens] Length = 636 Score = 72.0 bits (175), Expect = 4e-12 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 401 ARYLQFRKWPVEWGWCRDLQSFILIFERHNRCI 303 ARYL+FRKWPVEWGWCRDLQSFI +FERHNR + Sbjct: 460 ARYLRFRKWPVEWGWCRDLQSFIFVFERHNRIV 492 >KYP42211.1 hypothetical protein KK1_036396 [Cajanus cajan] Length = 649 Score = 72.0 bits (175), Expect = 4e-12 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 401 ARYLQFRKWPVEWGWCRDLQSFILIFERHNRCI 303 ARYL+FRKWPVEWGWCRDLQSFI +FERHNR + Sbjct: 473 ARYLKFRKWPVEWGWCRDLQSFIFVFERHNRIV 505