BLASTX nr result
ID: Panax24_contig00013966
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00013966 (1243 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017228703.1 PREDICTED: eukaryotic translation initiation fact... 166 7e-45 XP_011076724.1 PREDICTED: eukaryotic translation initiation fact... 165 2e-44 XP_019180760.1 PREDICTED: eukaryotic translation initiation fact... 164 3e-44 XP_002526864.1 PREDICTED: eukaryotic translation initiation fact... 163 8e-44 XP_012087805.1 PREDICTED: eukaryotic translation initiation fact... 163 1e-43 XP_010534569.1 PREDICTED: eukaryotic translation initiation fact... 163 1e-43 XP_015868987.1 PREDICTED: eukaryotic translation initiation fact... 159 1e-43 XP_010534462.1 PREDICTED: eukaryotic translation initiation fact... 163 1e-43 XP_010534390.1 PREDICTED: eukaryotic translation initiation fact... 163 1e-43 KVI09911.1 JAB1/Mov34/MPN/PAD-1 [Cynara cardunculus var. scolymus] 162 2e-43 XP_002279347.1 PREDICTED: eukaryotic translation initiation fact... 162 2e-43 XP_009791111.1 PREDICTED: eukaryotic translation initiation fact... 161 4e-43 CDP14052.1 unnamed protein product [Coffea canephora] 161 4e-43 OAY46221.1 hypothetical protein MANES_07G126500 [Manihot esculenta] 162 5e-43 KFK36891.1 hypothetical protein AALP_AA4G185500 [Arabis alpina] 161 5e-43 OMO88209.1 JAB1/Mov34/MPN/PAD-1 [Corchorus capsularis] 161 6e-43 XP_006295396.1 hypothetical protein CARUB_v10024491mg [Capsella ... 161 7e-43 XP_010269397.1 PREDICTED: eukaryotic translation initiation fact... 160 8e-43 XP_006411243.1 hypothetical protein EUTSA_v10016933mg [Eutrema s... 162 8e-43 XP_009133395.1 PREDICTED: eukaryotic translation initiation fact... 160 1e-42 >XP_017228703.1 PREDICTED: eukaryotic translation initiation factor 3 subunit F [Daucus carota subsp. sativus] KZM80553.1 hypothetical protein DCAR_032139 [Daucus carota subsp. sativus] Length = 285 Score = 166 bits (420), Expect = 7e-45 Identities = 81/90 (90%), Positives = 82/90 (91%) Frame = -1 Query: 1243 TSLSAKVHPLVIFNICDCFVRRPDQVERVISTLLGSVLPDGTVDIRNSYAVPHNESSDQV 1064 TSLSAKVHPLVIFNICDCFVRRPDQ ERVI TLLGSVLPDGTVDIRNSYAVPHNES DQV Sbjct: 16 TSLSAKVHPLVIFNICDCFVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESLDQV 75 Query: 1063 ALDIDYHHNMLASHLKVNPKEVMVGCLCKG 974 ALDIDYHHNMLASH KVNPKEV+VG G Sbjct: 76 ALDIDYHHNMLASHQKVNPKEVIVGWFSTG 105 >XP_011076724.1 PREDICTED: eukaryotic translation initiation factor 3 subunit F-like [Sesamum indicum] Length = 284 Score = 165 bits (417), Expect = 2e-44 Identities = 85/127 (66%), Positives = 93/127 (73%), Gaps = 2/127 (1%) Frame = -1 Query: 1243 TSLSAKVHPLVIFNICDCFVRRPDQVERVISTLLGSVLPDGTVDIRNSYAVPHNESSDQV 1064 TS+SA+VHPLVIFNICDC+VRRPDQ ERVI TLLGSVLPDGTVDIRNSYAVPHNESSDQV Sbjct: 16 TSVSARVHPLVIFNICDCYVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQV 75 Query: 1063 ALDIDYHHNMLASHLKVNPKEVMVGCLCKGEPXXXXXXXXXXXRSYLIGTFHLQVPQ--R 890 ALDIDYHHNML+SH KVNPKEV+VG G + HL V R Sbjct: 76 ALDIDYHHNMLSSHQKVNPKEVIVGWFSTGTVTGGSALIHEFYSREVSNPIHLTVDTEFR 135 Query: 889 NGNQNVK 869 +GN +K Sbjct: 136 SGNAAIK 142 >XP_019180760.1 PREDICTED: eukaryotic translation initiation factor 3 subunit F [Ipomoea nil] Length = 286 Score = 164 bits (416), Expect = 3e-44 Identities = 79/90 (87%), Positives = 82/90 (91%) Frame = -1 Query: 1243 TSLSAKVHPLVIFNICDCFVRRPDQVERVISTLLGSVLPDGTVDIRNSYAVPHNESSDQV 1064 T+LSA+VHPLVIFNICDCFVRRPDQ ERVI TLLGSVLPDGTVDIRNSYAVPHNES DQV Sbjct: 17 TTLSARVHPLVIFNICDCFVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESQDQV 76 Query: 1063 ALDIDYHHNMLASHLKVNPKEVMVGCLCKG 974 ALDIDYHHNMLASH KVNPKEV+VG G Sbjct: 77 ALDIDYHHNMLASHQKVNPKEVIVGWFSTG 106 >XP_002526864.1 PREDICTED: eukaryotic translation initiation factor 3 subunit F [Ricinus communis] EEF35495.1 eukaryotic translation initiation factor 3f, eif3f, putative [Ricinus communis] Length = 287 Score = 163 bits (413), Expect = 8e-44 Identities = 79/90 (87%), Positives = 81/90 (90%) Frame = -1 Query: 1243 TSLSAKVHPLVIFNICDCFVRRPDQVERVISTLLGSVLPDGTVDIRNSYAVPHNESSDQV 1064 T LSAKVHPLVIFNICDC+VRRPDQ ERVI TLLGSVLPDGTVDIRNSYAVPHNESSDQV Sbjct: 18 TGLSAKVHPLVIFNICDCYVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQV 77 Query: 1063 ALDIDYHHNMLASHLKVNPKEVMVGCLCKG 974 ALDIDYHHNML SH KVNPKEV+VG G Sbjct: 78 ALDIDYHHNMLLSHQKVNPKEVIVGWYSTG 107 >XP_012087805.1 PREDICTED: eukaryotic translation initiation factor 3 subunit F [Jatropha curcas] KDP44817.1 hypothetical protein JCGZ_01317 [Jatropha curcas] Length = 283 Score = 163 bits (412), Expect = 1e-43 Identities = 79/89 (88%), Positives = 81/89 (91%) Frame = -1 Query: 1240 SLSAKVHPLVIFNICDCFVRRPDQVERVISTLLGSVLPDGTVDIRNSYAVPHNESSDQVA 1061 SLSAKVHPLVIFNICDC+VRRPDQ ERVI TLLGSVLPDGTVDIRNSYAVPHNESSDQVA Sbjct: 15 SLSAKVHPLVIFNICDCYVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQVA 74 Query: 1060 LDIDYHHNMLASHLKVNPKEVMVGCLCKG 974 LDIDYHHNML SH KVNPKEV+VG G Sbjct: 75 LDIDYHHNMLLSHQKVNPKEVIVGWYSTG 103 >XP_010534569.1 PREDICTED: eukaryotic translation initiation factor 3 subunit F [Tarenaya hassleriana] Length = 296 Score = 163 bits (413), Expect = 1e-43 Identities = 78/88 (88%), Positives = 82/88 (93%) Frame = -1 Query: 1237 LSAKVHPLVIFNICDCFVRRPDQVERVISTLLGSVLPDGTVDIRNSYAVPHNESSDQVAL 1058 LSA+VHPLVIFNICDC+VRRPDQ ERVI TLLGSVLPDGTVDIRNSYAVPHNESSDQVAL Sbjct: 29 LSARVHPLVIFNICDCYVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQVAL 88 Query: 1057 DIDYHHNMLASHLKVNPKEVMVGCLCKG 974 DIDYHHNMLASH+KVNPKEV+VG G Sbjct: 89 DIDYHHNMLASHVKVNPKEVIVGWYSTG 116 >XP_015868987.1 PREDICTED: eukaryotic translation initiation factor 3 subunit F-like [Ziziphus jujuba] Length = 179 Score = 159 bits (403), Expect = 1e-43 Identities = 76/89 (85%), Positives = 81/89 (91%) Frame = -1 Query: 1240 SLSAKVHPLVIFNICDCFVRRPDQVERVISTLLGSVLPDGTVDIRNSYAVPHNESSDQVA 1061 SLSAKVHPLVIFNICDC+VRRPDQ +RVI TLLGS+LPDGTVDIRNSYAVPH+ESSDQVA Sbjct: 17 SLSAKVHPLVIFNICDCYVRRPDQADRVIGTLLGSILPDGTVDIRNSYAVPHSESSDQVA 76 Query: 1060 LDIDYHHNMLASHLKVNPKEVMVGCLCKG 974 LDIDYHHNML SH KVNPKEV+VG G Sbjct: 77 LDIDYHHNMLISHQKVNPKEVIVGWYSTG 105 >XP_010534462.1 PREDICTED: eukaryotic translation initiation factor 3 subunit F isoform X2 [Tarenaya hassleriana] Length = 292 Score = 163 bits (412), Expect = 1e-43 Identities = 78/88 (88%), Positives = 82/88 (93%) Frame = -1 Query: 1237 LSAKVHPLVIFNICDCFVRRPDQVERVISTLLGSVLPDGTVDIRNSYAVPHNESSDQVAL 1058 LSA+VHPLVIFNICDCFVRRPDQ ERVI TLLGSVLPDGTVDIRNSYAVPHNES++QVAL Sbjct: 26 LSARVHPLVIFNICDCFVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESTEQVAL 85 Query: 1057 DIDYHHNMLASHLKVNPKEVMVGCLCKG 974 DIDYHHNMLASHLKVNPKEV+VG G Sbjct: 86 DIDYHHNMLASHLKVNPKEVIVGWYSTG 113 >XP_010534390.1 PREDICTED: eukaryotic translation initiation factor 3 subunit F isoform X1 [Tarenaya hassleriana] Length = 293 Score = 163 bits (412), Expect = 1e-43 Identities = 78/88 (88%), Positives = 82/88 (93%) Frame = -1 Query: 1237 LSAKVHPLVIFNICDCFVRRPDQVERVISTLLGSVLPDGTVDIRNSYAVPHNESSDQVAL 1058 LSA+VHPLVIFNICDCFVRRPDQ ERVI TLLGSVLPDGTVDIRNSYAVPHNES++QVAL Sbjct: 26 LSARVHPLVIFNICDCFVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESTEQVAL 85 Query: 1057 DIDYHHNMLASHLKVNPKEVMVGCLCKG 974 DIDYHHNMLASHLKVNPKEV+VG G Sbjct: 86 DIDYHHNMLASHLKVNPKEVIVGWYSTG 113 >KVI09911.1 JAB1/Mov34/MPN/PAD-1 [Cynara cardunculus var. scolymus] Length = 285 Score = 162 bits (411), Expect = 2e-43 Identities = 77/90 (85%), Positives = 82/90 (91%) Frame = -1 Query: 1243 TSLSAKVHPLVIFNICDCFVRRPDQVERVISTLLGSVLPDGTVDIRNSYAVPHNESSDQV 1064 +SLSAKVHPLVIFNICDCFVRRPDQ ERVI TLLGS+LPDGTVDIRNSY VPHNESSDQV Sbjct: 16 SSLSAKVHPLVIFNICDCFVRRPDQAERVIGTLLGSILPDGTVDIRNSYVVPHNESSDQV 75 Query: 1063 ALDIDYHHNMLASHLKVNPKEVMVGCLCKG 974 ALDIDYHHN+L+SH KVNPKEV+VG G Sbjct: 76 ALDIDYHHNLLSSHQKVNPKEVIVGWFSTG 105 >XP_002279347.1 PREDICTED: eukaryotic translation initiation factor 3 subunit F [Vitis vinifera] CBI31529.3 unnamed protein product, partial [Vitis vinifera] Length = 285 Score = 162 bits (410), Expect = 2e-43 Identities = 78/90 (86%), Positives = 81/90 (90%) Frame = -1 Query: 1243 TSLSAKVHPLVIFNICDCFVRRPDQVERVISTLLGSVLPDGTVDIRNSYAVPHNESSDQV 1064 TSLSAKVHPLVIFNICDC+VRRPDQ ERVI TLLGS+ PDGTVDIRNSYAVPHNESSDQV Sbjct: 16 TSLSAKVHPLVIFNICDCYVRRPDQAERVIGTLLGSISPDGTVDIRNSYAVPHNESSDQV 75 Query: 1063 ALDIDYHHNMLASHLKVNPKEVMVGCLCKG 974 ALDIDYHHNML SH KVNPKEV+VG G Sbjct: 76 ALDIDYHHNMLLSHQKVNPKEVIVGWYSTG 105 >XP_009791111.1 PREDICTED: eukaryotic translation initiation factor 3 subunit F-like [Nicotiana sylvestris] XP_019257033.1 PREDICTED: eukaryotic translation initiation factor 3 subunit F-like [Nicotiana attenuata] OIS95984.1 eukaryotic translation initiation factor 3 subunit f [Nicotiana attenuata] Length = 285 Score = 161 bits (408), Expect = 4e-43 Identities = 77/90 (85%), Positives = 82/90 (91%) Frame = -1 Query: 1243 TSLSAKVHPLVIFNICDCFVRRPDQVERVISTLLGSVLPDGTVDIRNSYAVPHNESSDQV 1064 TSLSAKVHPLVIFNICDC+VRRPDQ +RVI TLLGSVLPDGTVDIRNSYAVPH+ES DQV Sbjct: 16 TSLSAKVHPLVIFNICDCYVRRPDQADRVIGTLLGSVLPDGTVDIRNSYAVPHSESQDQV 75 Query: 1063 ALDIDYHHNMLASHLKVNPKEVMVGCLCKG 974 ALDIDYHHNML+SH KVNPKEV+VG G Sbjct: 76 ALDIDYHHNMLSSHQKVNPKEVIVGWFSTG 105 >CDP14052.1 unnamed protein product [Coffea canephora] Length = 285 Score = 161 bits (408), Expect = 4e-43 Identities = 77/90 (85%), Positives = 82/90 (91%) Frame = -1 Query: 1243 TSLSAKVHPLVIFNICDCFVRRPDQVERVISTLLGSVLPDGTVDIRNSYAVPHNESSDQV 1064 T+L+A++HPLVIFNICDCFVRRPDQ ERVI TLLGSVLPDGTVDIRNSYAVPHNESSDQV Sbjct: 16 TNLTARIHPLVIFNICDCFVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQV 75 Query: 1063 ALDIDYHHNMLASHLKVNPKEVMVGCLCKG 974 ALDIDYHHNMLAS KVNPKEV+VG G Sbjct: 76 ALDIDYHHNMLASQQKVNPKEVIVGWFSTG 105 >OAY46221.1 hypothetical protein MANES_07G126500 [Manihot esculenta] Length = 315 Score = 162 bits (410), Expect = 5e-43 Identities = 78/90 (86%), Positives = 82/90 (91%) Frame = -1 Query: 1243 TSLSAKVHPLVIFNICDCFVRRPDQVERVISTLLGSVLPDGTVDIRNSYAVPHNESSDQV 1064 ++LSAKVHPLVIFNICDC+VRRPDQ ERVI TLLGSVLPDGTVDIRNSYAVPHNESSDQV Sbjct: 18 STLSAKVHPLVIFNICDCYVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQV 77 Query: 1063 ALDIDYHHNMLASHLKVNPKEVMVGCLCKG 974 ALDIDYHHNML SH KVNPKEV+VG G Sbjct: 78 ALDIDYHHNMLLSHQKVNPKEVIVGWYSTG 107 >KFK36891.1 hypothetical protein AALP_AA4G185500 [Arabis alpina] Length = 293 Score = 161 bits (408), Expect = 5e-43 Identities = 75/90 (83%), Positives = 82/90 (91%) Frame = -1 Query: 1243 TSLSAKVHPLVIFNICDCFVRRPDQVERVISTLLGSVLPDGTVDIRNSYAVPHNESSDQV 1064 T L+A++HPLVIFN+CDCFVRRPD ERVI TLLGS+LPDGTVDIRNSYAVPHNESSDQV Sbjct: 24 TVLTARIHPLVIFNVCDCFVRRPDSAERVIGTLLGSILPDGTVDIRNSYAVPHNESSDQV 83 Query: 1063 ALDIDYHHNMLASHLKVNPKEVMVGCLCKG 974 A+DIDYHHNMLASHLKVNPKEV+VG G Sbjct: 84 AVDIDYHHNMLASHLKVNPKEVIVGWYSTG 113 >OMO88209.1 JAB1/Mov34/MPN/PAD-1 [Corchorus capsularis] Length = 286 Score = 161 bits (407), Expect = 6e-43 Identities = 78/89 (87%), Positives = 81/89 (91%) Frame = -1 Query: 1240 SLSAKVHPLVIFNICDCFVRRPDQVERVISTLLGSVLPDGTVDIRNSYAVPHNESSDQVA 1061 SLSAKVHPLVIFNICDC+VRRPDQ ERVI TLLGSVLPDGTVDIRNSYAVPH ESSDQVA Sbjct: 18 SLSAKVHPLVIFNICDCYVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHTESSDQVA 77 Query: 1060 LDIDYHHNMLASHLKVNPKEVMVGCLCKG 974 LDI+YHHNMLASH KVNPKEV+VG G Sbjct: 78 LDIEYHHNMLASHQKVNPKEVIVGWYSTG 106 >XP_006295396.1 hypothetical protein CARUB_v10024491mg [Capsella rubella] EOA28294.1 hypothetical protein CARUB_v10024491mg [Capsella rubella] Length = 294 Score = 161 bits (407), Expect = 7e-43 Identities = 74/90 (82%), Positives = 82/90 (91%) Frame = -1 Query: 1243 TSLSAKVHPLVIFNICDCFVRRPDQVERVISTLLGSVLPDGTVDIRNSYAVPHNESSDQV 1064 T L+A++HPLVIFN+CDCFVRRPD ERVI TLLGS+LPDGTVDIRNSYAVPHNESSDQV Sbjct: 25 TVLTARIHPLVIFNVCDCFVRRPDSAERVIGTLLGSILPDGTVDIRNSYAVPHNESSDQV 84 Query: 1063 ALDIDYHHNMLASHLKVNPKEVMVGCLCKG 974 A+DIDYHHNMLASHLKVNPKE++VG G Sbjct: 85 AVDIDYHHNMLASHLKVNPKEIIVGWYSTG 114 >XP_010269397.1 PREDICTED: eukaryotic translation initiation factor 3 subunit F-like [Nelumbo nucifera] Length = 285 Score = 160 bits (406), Expect = 8e-43 Identities = 77/90 (85%), Positives = 81/90 (90%) Frame = -1 Query: 1243 TSLSAKVHPLVIFNICDCFVRRPDQVERVISTLLGSVLPDGTVDIRNSYAVPHNESSDQV 1064 TSLSAKVHP+VIFNICDC+VRRPDQ ERVI TLLGS+ PDGTVDIRNSYAVPHNESSDQV Sbjct: 16 TSLSAKVHPVVIFNICDCYVRRPDQAERVIGTLLGSISPDGTVDIRNSYAVPHNESSDQV 75 Query: 1063 ALDIDYHHNMLASHLKVNPKEVMVGCLCKG 974 ALDIDYHHNML SH KVNPKEV+VG G Sbjct: 76 ALDIDYHHNMLYSHQKVNPKEVIVGWYSTG 105 >XP_006411243.1 hypothetical protein EUTSA_v10016933mg [Eutrema salsugineum] ESQ52696.1 hypothetical protein EUTSA_v10016933mg [Eutrema salsugineum] Length = 325 Score = 162 bits (409), Expect = 8e-43 Identities = 75/88 (85%), Positives = 81/88 (92%) Frame = -1 Query: 1237 LSAKVHPLVIFNICDCFVRRPDQVERVISTLLGSVLPDGTVDIRNSYAVPHNESSDQVAL 1058 L+A++HPLVIFN+CDCFVRRPD ERVI TLLGS+LPDGTVDIRNSYAVPHNESSDQVA+ Sbjct: 58 LTARIHPLVIFNVCDCFVRRPDSAERVIGTLLGSILPDGTVDIRNSYAVPHNESSDQVAV 117 Query: 1057 DIDYHHNMLASHLKVNPKEVMVGCLCKG 974 DIDYHHNMLASHLKVNPKEVMVG G Sbjct: 118 DIDYHHNMLASHLKVNPKEVMVGWYSTG 145 >XP_009133395.1 PREDICTED: eukaryotic translation initiation factor 3 subunit F [Brassica rapa] Length = 293 Score = 160 bits (405), Expect = 1e-42 Identities = 74/88 (84%), Positives = 81/88 (92%) Frame = -1 Query: 1237 LSAKVHPLVIFNICDCFVRRPDQVERVISTLLGSVLPDGTVDIRNSYAVPHNESSDQVAL 1058 L+A++HPLVIFN+CDCFVRRPD ERVI TLLGS+LPDGTVDIRNSYAVPHNESSDQVA+ Sbjct: 26 LTARIHPLVIFNVCDCFVRRPDSAERVIGTLLGSILPDGTVDIRNSYAVPHNESSDQVAV 85 Query: 1057 DIDYHHNMLASHLKVNPKEVMVGCLCKG 974 DIDYHHNMLASHLKVNPKEV+VG G Sbjct: 86 DIDYHHNMLASHLKVNPKEVIVGWYSTG 113