BLASTX nr result
ID: Panax24_contig00013872
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00013872 (438 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017222506.1 PREDICTED: F-box/kelch-repeat protein At3g23880-l... 71 9e-12 XP_016566106.1 PREDICTED: F-box/kelch-repeat protein At3g23880-l... 59 3e-07 XP_011077563.1 PREDICTED: F-box/kelch-repeat protein At3g23880-l... 55 4e-06 XP_011077554.1 PREDICTED: F-box/kelch-repeat protein At3g23880-l... 55 4e-06 >XP_017222506.1 PREDICTED: F-box/kelch-repeat protein At3g23880-like [Daucus carota subsp. sativus] KZM85981.1 hypothetical protein DCAR_026597 [Daucus carota subsp. sativus] Length = 388 Score = 71.2 bits (173), Expect = 9e-12 Identities = 31/47 (65%), Positives = 39/47 (82%) Frame = +3 Query: 3 NGDILLEFESHLILYNANDSTFKDPEIHKFDGCLEADTYVESLVSPN 143 NGD+L+EFES ++LYN+ + FKD EI F GCLEADTY+ESLVSP+ Sbjct: 341 NGDVLVEFESQILLYNSKSNVFKDLEITNFGGCLEADTYIESLVSPH 387 >XP_016566106.1 PREDICTED: F-box/kelch-repeat protein At3g23880-like [Capsicum annuum] Length = 399 Score = 58.5 bits (140), Expect = 3e-07 Identities = 25/45 (55%), Positives = 34/45 (75%) Frame = +3 Query: 6 GDILLEFESHLILYNANDSTFKDPEIHKFDGCLEADTYVESLVSP 140 G+ILL F S ++YN ND + K PE++ FD CLEA+ Y+ESL+SP Sbjct: 344 GEILLVFGSIFMIYNPNDDSIKYPELNNFDACLEAEIYIESLISP 388 >XP_011077563.1 PREDICTED: F-box/kelch-repeat protein At3g23880-like isoform X2 [Sesamum indicum] Length = 338 Score = 55.1 bits (131), Expect = 4e-06 Identities = 24/46 (52%), Positives = 31/46 (67%) Frame = +3 Query: 3 NGDILLEFESHLILYNANDSTFKDPEIHKFDGCLEADTYVESLVSP 140 NG+ILL F HL++YN D+ + PE F LEAD Y+ESL+SP Sbjct: 288 NGEILLVFGMHLVVYNPKDNCLRHPETSNFGAFLEADVYIESLISP 333 >XP_011077554.1 PREDICTED: F-box/kelch-repeat protein At3g23880-like isoform X1 [Sesamum indicum] Length = 406 Score = 55.1 bits (131), Expect = 4e-06 Identities = 24/46 (52%), Positives = 31/46 (67%) Frame = +3 Query: 3 NGDILLEFESHLILYNANDSTFKDPEIHKFDGCLEADTYVESLVSP 140 NG+ILL F HL++YN D+ + PE F LEAD Y+ESL+SP Sbjct: 356 NGEILLVFGMHLVVYNPKDNCLRHPETSNFGAFLEADVYIESLISP 401