BLASTX nr result
ID: Panax24_contig00013825
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00013825 (386 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006387375.1 hypothetical protein POPTR_1135s00200g [Populus t... 66 7e-11 XP_002313238.2 hypothetical protein POPTR_0009s07860g [Populus t... 67 1e-10 XP_002313239.2 hypothetical protein POPTR_0009s07860g [Populus t... 66 2e-10 KZM96992.1 hypothetical protein DCAR_015646 [Daucus carota subsp... 66 2e-10 KCW54679.1 hypothetical protein EUGRSUZ_I00620 [Eucalyptus grandis] 63 2e-10 XP_017243600.1 PREDICTED: probable phytol kinase 3, chloroplasti... 66 3e-10 XP_016551793.1 PREDICTED: probable phytol kinase 3, chloroplasti... 65 4e-10 KCW54680.1 hypothetical protein EUGRSUZ_I00620 [Eucalyptus grand... 63 4e-10 OAY24181.1 hypothetical protein MANES_18G141200 [Manihot esculenta] 65 4e-10 XP_013606418.1 PREDICTED: probable phytol kinase 2, chloroplasti... 65 4e-10 XP_013671822.1 PREDICTED: probable phytol kinase 2, chloroplasti... 65 4e-10 XP_013716853.1 PREDICTED: probable phytol kinase 2, chloroplasti... 65 5e-10 XP_007205802.1 hypothetical protein PRUPE_ppa010668mg [Prunus pe... 65 5e-10 XP_016551792.1 PREDICTED: farnesol kinase, chloroplastic isoform... 65 5e-10 XP_016551790.1 PREDICTED: farnesol kinase, chloroplastic isoform... 65 6e-10 XP_002516647.1 PREDICTED: probable phytol kinase 2, chloroplasti... 65 6e-10 XP_004294311.1 PREDICTED: probable phytol kinase 2, chloroplasti... 65 7e-10 OAY24180.1 hypothetical protein MANES_18G141200 [Manihot esculenta] 64 7e-10 XP_006354090.1 PREDICTED: probable phytol kinase 3, chloroplasti... 65 8e-10 XP_004246260.1 PREDICTED: probable phytol kinase 3, chloroplasti... 65 8e-10 >XP_006387375.1 hypothetical protein POPTR_1135s00200g [Populus trichocarpa] ERP46289.1 hypothetical protein POPTR_1135s00200g [Populus trichocarpa] Length = 174 Score = 65.9 bits (159), Expect = 7e-11 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +1 Query: 196 QKLNRKLVHVSIGLVFMLCWPLFSSGRQGALCGTF 300 QKLNRKLVH+SIGLVFMLCWP+FSSGR+GAL F Sbjct: 39 QKLNRKLVHISIGLVFMLCWPIFSSGRRGALFAAF 73 >XP_002313238.2 hypothetical protein POPTR_0009s07860g [Populus trichocarpa] EEE87193.2 hypothetical protein POPTR_0009s07860g [Populus trichocarpa] Length = 313 Score = 67.0 bits (162), Expect = 1e-10 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +1 Query: 190 FIQKLNRKLVHVSIGLVFMLCWPLFSSGRQGALCGTF 300 F QKLNRKLVH+SIGLVFMLCWP+FSSGR+GAL F Sbjct: 109 FDQKLNRKLVHISIGLVFMLCWPIFSSGRRGALFAAF 145 >XP_002313239.2 hypothetical protein POPTR_0009s07860g [Populus trichocarpa] EEE87194.2 hypothetical protein POPTR_0009s07860g [Populus trichocarpa] Length = 237 Score = 65.9 bits (159), Expect = 2e-10 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +1 Query: 196 QKLNRKLVHVSIGLVFMLCWPLFSSGRQGALCGTF 300 QKLNRKLVH+SIGLVFMLCWP+FSSGR+GAL F Sbjct: 35 QKLNRKLVHISIGLVFMLCWPIFSSGRRGALFAAF 69 >KZM96992.1 hypothetical protein DCAR_015646 [Daucus carota subsp. sativus] Length = 241 Score = 65.9 bits (159), Expect = 2e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 190 FIQKLNRKLVHVSIGLVFMLCWPLFSSGRQGAL 288 F QKLNRKLVH+SIGLVFMLCWPLFSSG QGAL Sbjct: 37 FDQKLNRKLVHISIGLVFMLCWPLFSSGHQGAL 69 >KCW54679.1 hypothetical protein EUGRSUZ_I00620 [Eucalyptus grandis] Length = 118 Score = 63.2 bits (152), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +1 Query: 190 FIQKLNRKLVHVSIGLVFMLCWPLFSSGRQGAL 288 F QKLNRKLVHVS GLVFMLCWPLFSSG +GAL Sbjct: 37 FDQKLNRKLVHVSFGLVFMLCWPLFSSGHRGAL 69 >XP_017243600.1 PREDICTED: probable phytol kinase 3, chloroplastic [Daucus carota subsp. sativus] Length = 303 Score = 65.9 bits (159), Expect = 3e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 190 FIQKLNRKLVHVSIGLVFMLCWPLFSSGRQGAL 288 F QKLNRKLVH+SIGLVFMLCWPLFSSG QGAL Sbjct: 99 FDQKLNRKLVHISIGLVFMLCWPLFSSGHQGAL 131 >XP_016551793.1 PREDICTED: probable phytol kinase 3, chloroplastic isoform X3 [Capsicum annuum] Length = 219 Score = 64.7 bits (156), Expect = 4e-10 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 187 FFIQKLNRKLVHVSIGLVFMLCWPLFSSGRQGAL 288 FF QK NRKLVH+SIGLVFMLCWP+FSSG QGA+ Sbjct: 91 FFDQKTNRKLVHISIGLVFMLCWPMFSSGHQGAI 124 >KCW54680.1 hypothetical protein EUGRSUZ_I00620 [Eucalyptus grandis] KCW54681.1 hypothetical protein EUGRSUZ_I00620 [Eucalyptus grandis] Length = 141 Score = 63.2 bits (152), Expect = 4e-10 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +1 Query: 190 FIQKLNRKLVHVSIGLVFMLCWPLFSSGRQGAL 288 F QKLNRKLVHVS GLVFMLCWPLFSSG +GAL Sbjct: 37 FDQKLNRKLVHVSFGLVFMLCWPLFSSGHRGAL 69 >OAY24181.1 hypothetical protein MANES_18G141200 [Manihot esculenta] Length = 297 Score = 65.5 bits (158), Expect = 4e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 190 FIQKLNRKLVHVSIGLVFMLCWPLFSSGRQGAL 288 F QKLNRKLVH+SIGLVFMLCWPLFSSGR+GA+ Sbjct: 93 FDQKLNRKLVHISIGLVFMLCWPLFSSGRRGAI 125 >XP_013606418.1 PREDICTED: probable phytol kinase 2, chloroplastic [Brassica oleracea var. oleracea] Length = 302 Score = 65.5 bits (158), Expect = 4e-10 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +1 Query: 187 FFIQKLNRKLVHVSIGLVFMLCWPLFSSGRQGAL 288 FF QKL RKLVH++IGLVFMLCWPLFSSGRQGAL Sbjct: 96 FFDQKLIRKLVHINIGLVFMLCWPLFSSGRQGAL 129 >XP_013671822.1 PREDICTED: probable phytol kinase 2, chloroplastic [Brassica napus] CDY66208.1 BnaCnng49970D [Brassica napus] Length = 302 Score = 65.5 bits (158), Expect = 4e-10 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +1 Query: 187 FFIQKLNRKLVHVSIGLVFMLCWPLFSSGRQGAL 288 FF QKL RKLVH++IGLVFMLCWPLFSSGRQGAL Sbjct: 96 FFDQKLIRKLVHINIGLVFMLCWPLFSSGRQGAL 129 >XP_013716853.1 PREDICTED: probable phytol kinase 2, chloroplastic [Brassica napus] Length = 317 Score = 65.5 bits (158), Expect = 5e-10 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +1 Query: 187 FFIQKLNRKLVHVSIGLVFMLCWPLFSSGRQGAL 288 FF QKL RKLVH++IGLVFMLCWPLFSSGRQGAL Sbjct: 111 FFDQKLIRKLVHINIGLVFMLCWPLFSSGRQGAL 144 >XP_007205802.1 hypothetical protein PRUPE_ppa010668mg [Prunus persica] Length = 241 Score = 64.7 bits (156), Expect = 5e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = +1 Query: 187 FFIQKLNRKLVHVSIGLVFMLCWPLFSSGRQGA 285 FF QKLNRK VHVSIGLVFMLCWPLFSSG QGA Sbjct: 36 FFDQKLNRKFVHVSIGLVFMLCWPLFSSGLQGA 68 >XP_016551792.1 PREDICTED: farnesol kinase, chloroplastic isoform X2 [Capsicum annuum] Length = 244 Score = 64.7 bits (156), Expect = 5e-10 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 187 FFIQKLNRKLVHVSIGLVFMLCWPLFSSGRQGAL 288 FF QK NRKLVH+SIGLVFMLCWP+FSSG QGA+ Sbjct: 91 FFDQKTNRKLVHISIGLVFMLCWPMFSSGHQGAI 124 >XP_016551790.1 PREDICTED: farnesol kinase, chloroplastic isoform X1 [Capsicum annuum] Length = 259 Score = 64.7 bits (156), Expect = 6e-10 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 187 FFIQKLNRKLVHVSIGLVFMLCWPLFSSGRQGAL 288 FF QK NRKLVH+SIGLVFMLCWP+FSSG QGA+ Sbjct: 91 FFDQKTNRKLVHISIGLVFMLCWPMFSSGHQGAI 124 >XP_002516647.1 PREDICTED: probable phytol kinase 2, chloroplastic [Ricinus communis] EEF45742.1 Phytol kinase 1, chloroplast precursor, putative [Ricinus communis] Length = 304 Score = 65.1 bits (157), Expect = 6e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +1 Query: 190 FIQKLNRKLVHVSIGLVFMLCWPLFSSGRQGAL 288 F QKLNRKLVH+SIGLVFMLCWPLFSSG QGA+ Sbjct: 100 FDQKLNRKLVHISIGLVFMLCWPLFSSGHQGAI 132 >XP_004294311.1 PREDICTED: probable phytol kinase 2, chloroplastic [Fragaria vesca subsp. vesca] Length = 316 Score = 65.1 bits (157), Expect = 7e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 190 FIQKLNRKLVHVSIGLVFMLCWPLFSSGRQGAL 288 F QKLNRKLVH+SIGLVFMLCWPLFSSG QGAL Sbjct: 112 FDQKLNRKLVHISIGLVFMLCWPLFSSGYQGAL 144 >OAY24180.1 hypothetical protein MANES_18G141200 [Manihot esculenta] Length = 240 Score = 64.3 bits (155), Expect = 7e-10 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +1 Query: 196 QKLNRKLVHVSIGLVFMLCWPLFSSGRQGAL 288 QKLNRKLVH+SIGLVFMLCWPLFSSGR+GA+ Sbjct: 38 QKLNRKLVHISIGLVFMLCWPLFSSGRRGAI 68 >XP_006354090.1 PREDICTED: probable phytol kinase 3, chloroplastic [Solanum tuberosum] Length = 293 Score = 64.7 bits (156), Expect = 8e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +1 Query: 190 FIQKLNRKLVHVSIGLVFMLCWPLFSSGRQGALCGTF 300 F QK NRKLVH+SIGLVFMLCWP+FSSG+QGA+ F Sbjct: 89 FDQKTNRKLVHISIGLVFMLCWPMFSSGQQGAILAAF 125 >XP_004246260.1 PREDICTED: probable phytol kinase 3, chloroplastic [Solanum lycopersicum] Length = 293 Score = 64.7 bits (156), Expect = 8e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +1 Query: 190 FIQKLNRKLVHVSIGLVFMLCWPLFSSGRQGALCGTF 300 F QK NRKLVH+SIGLVFMLCWP+FSSG+QGA+ F Sbjct: 89 FDQKTNRKLVHISIGLVFMLCWPMFSSGQQGAILAAF 125